KEGG   Heterocephalus glaber (naked mole rat): 101702952Help
Entry
101702952         CDS       T02812                                 

Gene name
Hat1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    101702952 (Hat1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101702952 (Hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGENFTFQIYKADMTCRGFREYHERLQTF
LMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQM
LILTPFQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFS
REKLMQGFNEDMAVEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLVS
PYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggtagaatataagagtgcagtagagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgagaatgacattagaactttctttcctgaatatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctgaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtggaggcagatgatgtggaaggcaaaatcagacaaatcattccacctggattttgc
acaaatacaaatgacttcctttctttgctggaaaaggaagttgatttcaagccatttgga
accctactccatacatactcagttctcagtccaacaggagaaaactttacttttcagata
tacaaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagaccttt
ttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcactac
tttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggctac
atgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcagatg
ctgatactgactccatttcaaggtcaaggccatggtgctcaacttcttgaaacagttcat
agatactacattgcatctccttcagttcttgatattacagcggaagacccatccaaaagt
tatgtgaaattaagagattttgtgcttgtgaagctttgtcaagatttgccctgtttttcc
cgggaaaaattaatgcaaggattcaatgaagatatggctgtagaagcacagcagaagttc
aaaataaataagcaacatgctagacgggtttatgaaattcttcgactgctggtgactgac
atgagtgatgctgagcaatacagaagctacaggctggatattaagagaagactggtcagc
ccttataagaaaaagcagagagatcttgctaagatgagaaaatgtctcaggccagaagaa
ttgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacaactggaagaaagc
tttcaggaactagtggaagattaccggcgtgttattgaacgactggctcaagagtaa

DBGET integrated database retrieval system