KEGG   Heterocephalus glaber (naked mole rat): 101703016Help
Entry
101703016         CDS       T02812                                 

Gene name
Lpl
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101703016 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101703016 (Lpl)
  Digestive system
   04979 Cholesterol metabolism
    101703016 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101703016 (Lpl)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101703016 (Lpl)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101703016 (Lpl)
  Exosomal proteins of breast milk
   101703016 (Lpl)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   101703016 (Lpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]
 Enzymes
  101703016 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 475 aa AA seqDB search
MDSKALLLVLLGSWLQSLTASRGGVAAANGGRDFMDIESKFALRTPEDTAEDTCHLIPGV
TESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLLRAQQH
YPVSAGYTKLVGEDVARFINWMEDEFNYPVDNVHLLGYSLGAHAAGIAGSRTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFDKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTQTNQ
AFEISLYGTVAESENIAFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFAWSNW
WSRPGFTIERIRVKAGETQKKVMFCSREKVSKLQKGKGSAVFVKCHDKSLIKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaggctctgctcctggtgctcctgggctcgtggctccagagtctgaccgcc
tcccggggaggggtagccgccgccaacggaggaagagattttatggacattgaaagtaaa
tttgccctaaggacccccgaggacacagctgaggacacttgccacctcattcctggagtg
acagaatctgtggctaactgccacttcaaccacagcagcaaaaccttcgtggtgatccat
ggctggacggtgacaggaatgtatgagagttgggtgccgaaacttgtggctgccctgtac
aagagggaaccagactccaatgtcatcgtggtggactggctgttgagggcccagcagcac
tatccagtgtctgcaggctacaccaagctggtgggagaagatgtagccaggtttatcaac
tggatggaggatgaatttaattaccctgtggacaatgtccatctcttgggatacagtctc
ggagcccacgctgctggcattgctggaagtcggaccaataagaaggtcaacagaattaca
ggcctggatccagccggccccaactttgagtatgcagaagctcccagtcgcctttctcct
gatgatgcagattttgtagatgtcttacacacattcaccagggggtcaccaggacgaagc
attggaatccagaaaccagtggggcatgttgacatttatcccaatggaggcacttttcaa
cccggatgcaacatcggggaagctatccgtgtgattgcagagaggggccttggagatgtg
gaccaactagtgaagtgctcccatgagcgctccattcatctcttcatcgactccctgttg
aatgaagagaacccaagtaaggcctacaggtgcaactccaaggaagcctttgacaaaggt
ctctgcctgagttgcagaaagaaccggtgcaacaacgtgggctatgagatcaacaaggtc
agagccaaaagaagcagcaagatgtatctgaagactcgttcccagatgccctacaaagtc
ttccattaccaagtaaagattcacttttctgggactgaaagtaacacgcagaccaaccag
gccttcgagatctctctgtatggcacggtggccgagagtgagaacatcgccttcacccta
cccgaagtgtccacaaataagacgtactccttcctgatctacacggaggtggacattgga
gagctcctaatgctgaagctcaagtggaagagtgactcctactttgcctggtcaaattgg
tggagcagacctggcttcaccatcgagaggatcagagtcaaagcaggagagacgcaaaag
aaggtgatgttctgttcccgggagaaagtgtcgaaactgcagaagggaaagggctctgcg
gtgttcgtgaaatgccacgacaagtctctgattaagaagtctggctga

DBGET integrated database retrieval system