KEGG   Heterocephalus glaber (naked mole rat): 101703016Help
Entry
101703016         CDS       T02812                                 

Gene name
Lpl
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101703016 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101703016 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101703016 (Lpl)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101703016 (Lpl)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101703016 (Lpl)
  Exosomal proteins of breast milk
   101703016 (Lpl)
Heparan sulfate/heparin binding proteins [BR:hgl00536]
 Enzymes (General comment) Variety
  101703016 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 475 aa AA seqDB search
MDSKALLLVLLGSWLQSLTASRGGVAAANGGRDFMDIESKFALRTPEDTAEDTCHLIPGV
TESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLLRAQQH
YPVSAGYTKLVGEDVARFINWMEDEFNYPVDNVHLLGYSLGAHAAGIAGSRTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFDKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTQTNQ
AFEISLYGTVAESENIAFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFAWSNW
WSRPGFTIERIRVKAGETQKKVMFCSREKVSKLQKGKGSAVFVKCHDKSLIKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaggctctgctcctggtgctcctgggctcgtggctccagagtctgaccgcc
tcccggggaggggtagccgccgccaacggaggaagagattttatggacattgaaagtaaa
tttgccctaaggacccccgaggacacagctgaggacacttgccacctcattcctggagtg
acagaatctgtggctaactgccacttcaaccacagcagcaaaaccttcgtggtgatccat
ggctggacggtgacaggaatgtatgagagttgggtgccgaaacttgtggctgccctgtac
aagagggaaccagactccaatgtcatcgtggtggactggctgttgagggcccagcagcac
tatccagtgtctgcaggctacaccaagctggtgggagaagatgtagccaggtttatcaac
tggatggaggatgaatttaattaccctgtggacaatgtccatctcttgggatacagtctc
ggagcccacgctgctggcattgctggaagtcggaccaataagaaggtcaacagaattaca
ggcctggatccagccggccccaactttgagtatgcagaagctcccagtcgcctttctcct
gatgatgcagattttgtagatgtcttacacacattcaccagggggtcaccaggacgaagc
attggaatccagaaaccagtggggcatgttgacatttatcccaatggaggcacttttcaa
cccggatgcaacatcggggaagctatccgtgtgattgcagagaggggccttggagatgtg
gaccaactagtgaagtgctcccatgagcgctccattcatctcttcatcgactccctgttg
aatgaagagaacccaagtaaggcctacaggtgcaactccaaggaagcctttgacaaaggt
ctctgcctgagttgcagaaagaaccggtgcaacaacgtgggctatgagatcaacaaggtc
agagccaaaagaagcagcaagatgtatctgaagactcgttcccagatgccctacaaagtc
ttccattaccaagtaaagattcacttttctgggactgaaagtaacacgcagaccaaccag
gccttcgagatctctctgtatggcacggtggccgagagtgagaacatcgccttcacccta
cccgaagtgtccacaaataagacgtactccttcctgatctacacggaggtggacattgga
gagctcctaatgctgaagctcaagtggaagagtgactcctactttgcctggtcaaattgg
tggagcagacctggcttcaccatcgagaggatcagagtcaaagcaggagagacgcaaaag
aaggtgatgttctgttcccgggagaaagtgtcgaaactgcagaagggaaagggctctgcg
gtgttcgtgaaatgccacgacaagtctctgattaagaagtctggctga

DBGET integrated database retrieval system