KEGG   Heterocephalus glaber (naked mole rat): 101703096Help
Entry
101703096         CDS       T02812                                 

Gene name
Ckmt2
Definition
(RefSeq) creatine kinase, mitochondrial 2
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00330  Arginine and proline metabolism
hgl01100  Metabolic pathways
Module
hgl_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101703096 (Ckmt2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101703096 (Ckmt2)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101703096 (Ckmt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 101703096
NCBI-ProteinID: XP_004841679
UniProt: G5BK72
Position
Un
AA seq 419 aa AA seqDB search
MASTFSKLLTGRNASLLLATVGTSALTSGYLLHRPKVCAEALGQHKLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHPTDLDASKITQGQFDERYVLSSRVRTGRSIRGLSLPPAC
SRAERREVENVAIAALQGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TEAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFSRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccttctccaagctgctcactggccgcaatgcctctctgctgctcgccact
gtgggcaccagcgccctgacctccggttacctgctgcaccggcccaaggtgtgcgcagag
gccctcggccaacacaagctgtttcccccaagcgctgactaccctgacctccgcaagcac
aacaactgcatggccgagtgcctcaccccggccatctacgccaagctccgcaacaagatg
acgcccagcggctacaccctggaccagtgcatccagaccggcgtggacaacccgggccac
cccttcatcaagacagtgggcatggtggccggggatgaggagtcctacgaggtgtttgct
gacctttttgaccctgtcatcaaactgaggcacaacggctacgacccccgggtgatgaag
caccccacagatctggacgcctccaagatcacccaggggcagttcgatgagcgctacgtg
ctgtcctcccgtgtgcgcaccgggcgcagcatccgcgggctcagcctgccacccgcctgc
tcgcgcgcggagcgcagggaggtggagaacgtggccatcgcggcgctccagggcctcaag
ggcgacctggccggccgctactacaagctgtcggagatgaccgagcaggaccagcagcgg
ctcatcgacgaccacttcctgtttgataagcccgtgtcccctttactgacctgtgctggg
atggcccgagactggccagacgccaggggaatctggcataactacgacaagacctttctc
atctggatcaatgaggaggaccacaccagggtcatctccatggaaaagggcggcaacatg
aaacgggtgttcgagcgattctgtcgcggactgaaggaagtggagcggctgatccaggag
cgcggctgggagttcatgtggaacgagcgtctggggtatatcctgacctgcccgtccaac
ctggggaccggactgcgggccggtgtccacgtgcggatcccgaagctcagcaaggaccca
cgtttttctaagatcttggagaacctcaggctccagaagcgtggcacgggtggcgtggac
accgaggcagtggcggacgtgtatgacatttccaacatcgatcggatcggcagatcagag
gtggagctggtgcagattgtcattgacggagtcaactacctggtggactgcgagaagaag
ctggagagaggccaggacatcaaggtgccgccgcctctgccgcagttcagccggaagtga

DBGET integrated database retrieval system