KEGG   Heterocephalus glaber (naked mole rat): 101704109Help
Entry
101704109         CDS       T02812                                 

Gene name
Gba
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101704109 (Gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101704109 (Gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101704109 (Gba)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101704109 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MEFSRPSIGERPKRRGRVAVATSLRGLLLLQAVAWASGARPCIPKSFGYSSVVCVCNATY
CDSLDPLTFPAMGTFSRYESTRSGRRMELSVGDFRSNRTGTGLLLTLQPEEKFQKVKGFG
GAMTDAAALNILALSPSAQNLLLESYFSKEGIEYNIIRVPMASCDFSIRTYTYDDTPGDF
QLHNFSLTEEDTKLKIPLIHRALQMSQRPVSLFASPWTSPTWLKTNGAVNGKGTLKGQPG
DIYHQTWAKYFVKFLDAYAEHRLKFWAVTVENEPSAGLMSGYPFQCLGFTPEHQRDFIAR
DLGPTLANSTHHDVQLIMLDDNRLLLPRWAQVVLGDPEAAKYVRGVAVHWYLDFLAPAKS
TLGATHRLFPDTMLFASEACVGSKFWEQSVRLGSWDRGTQYSSSVITNLLYHVVGWTDWN
LALNPEGGPNWVRNFVDSPIIVDIGKDTFYKQPMFYHLGHFSKFIPEGSHRVGLAASEDS
DLEAVALLHPDGSAVVVVLNRSSRDVPLTIQDPALGFLETISPGHSIHTYLWRRQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcacgtccttccataggggaacgtcccaaacgccggggcagggtagccgtg
gctaccagcctcaggggattgctcctgcttcaggcggtggcttgggcatcaggcgcccgc
ccctgcatccctaaaagctttggctacagctcggtggtctgtgtctgcaatgccacatac
tgtgactctcttgaccccctgaccttccctgccatggggaccttcagccgctatgagagc
acacgcagtggacgtcggatggagctgagtgtgggtgacttcaggtccaaccgcacgggc
acagggctgcttttgaccctgcagccggaagagaagttccagaaagtgaaaggatttgga
ggggccatgacagatgcggctgctctcaatatccttgccctgtcaccctctgcccagaac
ttgctgcttgaatcgtatttctctaaagaagggatcgaatataacatcatccgggtaccc
atggccagctgtgacttctccatccgcacctatacctatgacgacacccctggtgacttc
cagttgcacaatttcagcctcacagaggaagataccaagctcaagatacccctgattcac
cgggccctgcaaatgtcccagcgccctgtctcactctttgccagcccctggacgtcaccc
acttggctcaagaccaatggggcagtgaatgggaaggggacgctcaaggggcagcccggg
gacatctaccaccagacctgggccaagtacttcgtcaagttcctggacgcctatgctgag
cacaggttaaagttctgggcagtgacagttgagaacgagccttctgcagggctcatgagt
gggtaccccttccagtgtctgggcttcacccctgaacaccagcgagatttcattgcccgg
gacctgggtccaacgcttgccaacagcactcatcacgatgtccagctgatcatgctggat
gacaaccgcctgctgctgcctcgctgggctcaggtggtgctcggggacccagaagcggcc
aagtacgtccgaggggtcgctgtgcactggtacctggacttcctggctccggcaaagtct
actctgggggccacgcaccgcctgttccccgacaccatgctcttcgcctccgaggcctgt
gtaggctccaagttctgggagcagagcgtgcggctgggctcctgggaccgcgggacgcag
tacagcagcagtgtcatcacgaacctcctctaccatgtagtcggctggaccgactggaac
ctcgccctgaaccctgaggggggccctaactgggtccgcaactttgttgacagccccatc
attgtagatattggcaaggacacgttttacaaacagcccatgttttatcaccttggccac
ttcagcaagttcatccccgagggctctcatcgcgtggggctggcggccagtgaggacagc
gacctggaggctgtggcactgctgcatcctgacggctctgcagttgtggtcgtgctgaac
cgctcctccagggatgtgcctctcaccatccaggaccctgccctgggcttcctggagacc
atctcccctggccactccattcatacctacctgtggcgccgccagtga

DBGET integrated database retrieval system