KEGG   Heterocephalus glaber (naked mole rat): 101704109Help
Entry
101704109         CDS       T02812                                 

Gene name
Gba
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hgl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hgl00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hgl04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MEFSRPSIGERPKRRGRVAVATSLRGLLLLQAVAWASGARPCIPKSFGYSSVVCVCNATY
CDSLDPLTFPAMGTFSRYESTRSGRRMELSVGDFRSNRTGTGLLLTLQPEEKFQKVKGFG
GAMTDAAALNILALSPSAQNLLLESYFSKEGIEYNIIRVPMASCDFSIRTYTYDDTPGDF
QLHNFSLTEEDTKLKIPLIHRALQMSQRPVSLFASPWTSPTWLKTNGAVNGKGTLKGQPG
DIYHQTWAKYFVKFLDAYAEHRLKFWAVTVENEPSAGLMSGYPFQCLGFTPEHQRDFIAR
DLGPTLANSTHHDVQLIMLDDNRLLLPRWAQVVLGDPEAAKYVRGVAVHWYLDFLAPAKS
TLGATHRLFPDTMLFASEACVGSKFWEQSVRLGSWDRGTQYSSSVITNLLYHVVGWTDWN
LALNPEGGPNWVRNFVDSPIIVDIGKDTFYKQPMFYHLGHFSKFIPEGSHRVGLAASEDS
DLEAVALLHPDGSAVVVVLNRSSRDVPLTIQDPALGFLETISPGHSIHTYLWRRQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcacgtccttccataggggaacgtcccaaacgccggggcagggtagccgtg
gctaccagcctcaggggattgctcctgcttcaggcggtggcttgggcatcaggcgcccgc
ccctgcatccctaaaagctttggctacagctcggtggtctgtgtctgcaatgccacatac
tgtgactctcttgaccccctgaccttccctgccatggggaccttcagccgctatgagagc
acacgcagtggacgtcggatggagctgagtgtgggtgacttcaggtccaaccgcacgggc
acagggctgcttttgaccctgcagccggaagagaagttccagaaagtgaaaggatttgga
ggggccatgacagatgcggctgctctcaatatccttgccctgtcaccctctgcccagaac
ttgctgcttgaatcgtatttctctaaagaagggatcgaatataacatcatccgggtaccc
atggccagctgtgacttctccatccgcacctatacctatgacgacacccctggtgacttc
cagttgcacaatttcagcctcacagaggaagataccaagctcaagatacccctgattcac
cgggccctgcaaatgtcccagcgccctgtctcactctttgccagcccctggacgtcaccc
acttggctcaagaccaatggggcagtgaatgggaaggggacgctcaaggggcagcccggg
gacatctaccaccagacctgggccaagtacttcgtcaagttcctggacgcctatgctgag
cacaggttaaagttctgggcagtgacagttgagaacgagccttctgcagggctcatgagt
gggtaccccttccagtgtctgggcttcacccctgaacaccagcgagatttcattgcccgg
gacctgggtccaacgcttgccaacagcactcatcacgatgtccagctgatcatgctggat
gacaaccgcctgctgctgcctcgctgggctcaggtggtgctcggggacccagaagcggcc
aagtacgtccgaggggtcgctgtgcactggtacctggacttcctggctccggcaaagtct
actctgggggccacgcaccgcctgttccccgacaccatgctcttcgcctccgaggcctgt
gtaggctccaagttctgggagcagagcgtgcggctgggctcctgggaccgcgggacgcag
tacagcagcagtgtcatcacgaacctcctctaccatgtagtcggctggaccgactggaac
ctcgccctgaaccctgaggggggccctaactgggtccgcaactttgttgacagccccatc
attgtagatattggcaaggacacgttttacaaacagcccatgttttatcaccttggccac
ttcagcaagttcatccccgagggctctcatcgcgtggggctggcggccagtgaggacagc
gacctggaggctgtggcactgctgcatcctgacggctctgcagttgtggtcgtgctgaac
cgctcctccagggatgtgcctctcaccatccaggaccctgccctgggcttcctggagacc
atctcccctggccactccattcatacctacctgtggcgccgccagtga

DBGET integrated database retrieval system