KEGG   Heterocephalus glaber (naked mole rat): 101704183Help
Entry
101704183         CDS       T02812                                 

Gene name
Josd1, Josephin-1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDGNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggccaaatctgagtccttggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggaactttgtgccctacacgcc
ctcaataacgtcttccaggacggcaacgccttcacgcgggaaacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacaccccacaagaagagcatgctgggaaatggg
aactacgatgtgaacgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgctcttactaacgtcatggggttcatcatg
aatctgccctccagcctgtgctggggaccactcaagctgcccctcaaaaggcagcactgg
atctgcgtccgagaggtgggaggcgcctactacaaccttgactccaaactcaagatgcct
gagtggatcggaggcgagagtgaactcaggaaatttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtgccagaagaggtggaagcccatcagagctggagggcc
gatgtgtaa

DBGET integrated database retrieval system