KEGG   Heterocephalus glaber (naked mole rat): 101704643Help
Entry
101704643         CDS       T02812                                 

Gene name
C1galt1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101704643 (C1galt1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101704643 (C1galt1)
Glycosyltransferases [BR:hgl01003]
 Glycan extension
  Type 3 chain
   101704643 (C1galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 350 aa AA seqDB search
MSEIHFQEMASKSWLNILTFLCGSAIGFFFCSQLFSILLGEQGDTQPNILHNDPHARHSD
DNGQNHPEGQMNFNADSSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPTVGLKTKEGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDT
YVILDNLRWLLSKYSPEKPIYFGRRFKPFVKQGYMSGGAGYVLSKEALKRFIDAFKTEKC
THSSSIEDLALGKCMEVMNVEAGDSRDTTGKETFHPFVPEHHLIKSYLPRTFWYWNYNYY
PPVQGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRAYGYLYRYQPALPEN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacactttcaggaaatggcctctaaatcttggctgaatattttaaccttc
ctctgtggatcagcaataggattttttttttgttctcagctatttagtattttgttggga
gaacaaggtgacacccagcctaatattcttcataatgatcctcatgcaagacattcagat
gataatggacagaatcatccagaaggacaaatgaacttcaatgcagattctagccaacat
aaagatgagaacacagacatcgctgaaaacctgtaccagaaagttaaaattctttgttgg
gttatgacgggccctcaaaatctagagaaaaaggccaaacatgtcaaagctacatgggcc
caacgttgtaataaagtgttatttatgagttcagaagaaaataaagacttccctactgtg
ggcttaaaaaccaaagaaggtagagatcaactatactggaaaacaattaaagcttttcag
tatgttcatgaccattatttagaagatgcggattggtttatgaaagcagatgatgataca
tatgtcatactagacaatttgagatggcttctttcaaaatatagccctgaaaaacccatt
tattttgggagaagatttaagccctttgtaaagcagggttacatgagtggaggagcagga
tatgtactaagcaaagaagccttgaagagatttattgatgcgtttaaaacagaaaaatgt
acacatagttcttccattgaagacctagcactgggaaaatgcatggaagttatgaatgta
gaagctggggattccagagataccacaggaaaagaaacttttcatccctttgtaccagaa
caccacttaatcaaaagttatctacccagaaccttttggtactggaattataactattat
cctcctgtacagggccctggttgctgttctgatcttgcagtttcttttcactatgttgat
tctacaaccatgtatgaattagaatacctcgtttatcatcttcgtgcatatggttatttg
tatagatatcaacctgccttacctgaaaac

DBGET integrated database retrieval system