KEGG   Heterocephalus glaber (naked mole rat): 101705236Help
Entry
101705236         CDS       T02812                                 

Gene name
Gls2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101705236 (Gls2)
   00330 Arginine and proline metabolism
    101705236 (Gls2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101705236 (Gls2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101705236 (Gls2)
  Nervous system
   04724 Glutamatergic synapse
    101705236 (Gls2)
   04727 GABAergic synapse
    101705236 (Gls2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101705236 (Gls2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101705236 (Gls2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 666 aa AA seqDB search
MGAPGLGGQGGNRPLLLLQPHPRPSSPSPAQRSLTRLPRTCLARYSSDPLSLPAGAPTSW
ALWGLRSMRALQRALSLAISHCPWAGWGPLSRSPILGGGVWQHLSEAAAQGRETPHSHQP
QRQDHDASQSGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMY
HMAQESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTG
GKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTD
YVHKFVGKEPSGLRYNTLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLN
KMAGNEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVT
CESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFYVGLPAKSA
VSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPR
REGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMNMEQKDYDSRTALHVAAAEGHVEVVK
FLIEACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTISESQAEAAAEALSKE
NLESMV
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcacctggcctaggcggacagggagggaaccggcccctcctcctgctccagccc
cacccccggccctcttctccaagcccggctcagcgctccctcacaaggctcccccgcacc
tgtctcgcccgctactcctccgaccctctctccctcccagccggcgctccgacgtcctgg
gcgctttggggcttgcgctccatgagggctctgcagcgtgcgctgagcctggccatcagt
cactgcccgtgggcaggctggggtcccctgagtcggagccccatccttggcgggggcgtc
tggcaacacctcagtgaggccgcggcgcagggcagggagacgccgcacagccaccagccg
cagcgccaggatcatgatgcgtcacagagtggcatgttgtcccgcctcggtgacttgctt
ttctacactattgctgagggacaggaacgaattcctatccacaagttcactacagcactg
aaagccactggactgcagacatcagatccccggctccgggactgcatgagccagatgtac
cacatggcccaagagtccagcagtggtggtctcttggaccgagatctcttccaaaagtgt
gtgagcagcaacattgtgctcctgacccaggcattccgaaagaagtttgtcattcctgat
tttgaagagttcacgggccacgtggatcgcatctttgaagatgccaaagagctcactgga
ggcaaagtggcagcctacatccctcagctggccaagtcaaacccagacctctggggtgtc
tccctgtgcactgtggatggtcagcggcactctgtgggccacacaaagatccccttctgc
ctgcagtcctgtgtgaagccgctcacctacgccatctccataagtactctaggtactgac
tacgtgcacaagtttgtgggcaaggagcccagcggcctgcgctataacacactctccctc
aatgaggaaggaatcccccataaccccatggtgaatgctggtgccattgttgtcagctcc
ctgatcaagatggactgtaacaaagcagagaagtttgattttgtgttgcaatatctgaac
aaaatggctgggaatgaatacgtgggtttcagcaatgccacattccagtctgagaaagaa
actggggatcggaattatgccattggctattacctcaaggaaaagaagtgctttcctaag
ggggtggacatgatggctgcccttgatctctacttccagctgtgctccgtggaggtcacc
tgtgaatcaggcagtgttatggcggccacccttgccaatggcggcatctgccccatcaca
ggcgagagtgtgctgagcgccgaagcagtgcgtaacaccctcagcctcatgcattcctgc
ggcatgtatgacttctctggccagtttgccttctatgtgggcctgccagccaagtcagct
gtatcaggagccatcctcctggtggtacccaatgtcatgggaatgatgtgtctgtcccct
ccgctggacaagttggggaacagccagagagggatcaacttctgccagaagttggtgtct
ctctttaacttccacaactatgacaacctacggcactgtgctcggaaattagacccacgg
cgtgaagggggagaagttcggaacaagacagtggtgaacctgttatttgccgcctatagt
ggagatgtttcagctcttcgaaggtttgctttgtcagctatgaatatggaacagaaagac
tatgactcccgcacagctctgcatgttgctgcagccgaaggccacgtcgaagttgttaag
tttctgatcgaggcttgcaaagtgaatccttttgtgaaggacaggtggggcaacattccc
ctggatgatgctgtgcagttcaaccacctggaggtggtcaaattgcttcaagattaccag
gactcctacacaatctctgagtctcaggctgaggcagcagctgaagccctgtccaaagag
aacttagagagcatggtgtga

DBGET integrated database retrieval system