KEGG   Heterocephalus glaber (naked mole rat): 101705724Help
Entry
101705724         CDS       T02812                                 

Gene name
Ache
Definition
acetylcholinesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101705724 (Ache)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    101705724 (Ache)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     101705724 (Ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 613 aa AA seqDB search
MRPPWCPLHKPSLASPLLLLLSLLGAGVGAEGREDPELLVTVRGGRLRGIRLKAPGGLVS
AFLGIPFAEPPVGPRRFLPPEPKRPWTGVLDATTFPSVCYQYVDTLYPGFEGTEMWNPNR
ELSEDCLYLNVWTPYPRPASPLPVLIWIYGGGFYSGASSLDVYDGRFLAQAEGTVLVSMN
YRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVG
MHVLSPPSRSLFHRVVLQSGAPNGPWATVGMGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGV
VKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRIGVPQVSDLAAEAVVLHYTDWLHPED
PARLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAFVFEHRASTLTWPLWMGVPHGYE
IEFIFGLPLDPSLNYTNEEKIFAQRMMRYWANFARTGDPNDPRDAKAPQWPAYTAGAQQY
VSLNLQSLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgtggtgtcccctgcacaagccctccctggcctccccactcctcctcctc
ctctccctcctgggagcaggggtgggggctgagggccgggaggatccagagctgctggtg
acggttcgagggggccggcttcggggcattcgcctaaaggcccccgggggccttgtctct
gcttttctgggcatcccctttgcagagccacctgtgggtccccgacgctttctgccacca
gagcccaagcggccctggacaggggtgctggatgctacgaccttccctagtgtctgctac
caatatgtggacaccttgtaccccggttttgagggcaccgagatgtggaacccaaaccgt
gagctgagcgaggactgcctctacctcaatgtgtggacaccgtacccccggcctgcatcc
cccctccctgtcctcatctggatctatgggggaggcttctacagcggggcctcctccctg
gacgtgtatgatggccgcttcctggcacaggcagaggggacagtgctggtgtccatgaac
taccgggtgggaacctttggcttcttggccctaccagggagtcgagaggcacccggcaat
gtaggtctgctggatcagaggctggcactgcagtgggtgcaagagaatgtggcagctttc
ggaggggacccaacatcagtgactctgtttggggagagtgcaggcgctgcctctgtgggc
atgcatgtcctgtccccgcccagccggagcctcttccacagggtcgtgctgcagagcggt
gcacccaacgggccctgggccacagtgggcatgggagaggcccgccgcagggccacactg
ctggcccgccttgtaggctgtcccccgggtggtgctggtggcaatgacacagaactggta
gcctgcctgcggacacggccagctcaggatctggtggaccatgagtggcacgtgctgccc
caggaaagcatcttccggttttccttcgtgccagtggtggacggagacttcctcagtgac
acgcctgaggccctcatcaatgctggagatttccatggcctgcaggtgctggtgggtgtg
gtgaaggatgaggggtcctattttctggtttatggggccccaggcttcagcaaagacaac
gaatctctcatcagccgggcccagttcctggctggagtgcgcatcggggtcccccaggtg
agcgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcctgaggac
ccagcacgcttacgggacgccatgagtgctgtggtgggcgaccacaatgtcgtgtgccct
gtggcccagctggctgggcgactcgctgcccagggggcccgagtctatgcctttgtcttt
gaacaccgtgcctccacgctcacctggccactttggatgggggtgccccacggctacgag
attgagttcatctttggactacccctggacccctcgctgaactacaccaatgaggagaaa
atctttgcccagcgaatgatgagatactgggccaactttgcccgcacaggggaccccaat
gacccacgtgacgccaaagcccctcagtggcccgcatacactgcgggagctcagcagtac
gtgagcctcaacctgcagtccctggaggtgcggaggggacttcgcgcccaggcctgcgcc
ttctggaaccgcttcctgcccaaactgctcagtgcaaccgacacgctggacgaggcggag
cgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaaccag
ttcgaccattacagcaagcaggatcgctgttcagacctgtga

DBGET integrated database retrieval system