KEGG   Heterocephalus glaber (naked mole rat): 101706061Help
Entry
101706061         CDS       T02812                                 

Gene name
Kynu
Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hgl00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 461 aa AA seqDB search
MAASLPELPADRVQHIAAELRCHPTDEKVALLLDEEDVLRRFREYFYIPKMKDLPPIDLS
LVNKNDDAIYFLGHSLGLQPKMVKTYLEEELDKWAKIGAYGHDVGKRPWIIGDESIVGLM
KDIVGASEKEIALMNALSVNLHLLLLSFFKPTPKRHKILLEAKAFSSDHYAIESQLQLHG
LDVEKSMRMIKPREGEEILRMEDILEVIEKEGDSIAVILFSGVHFYTGQLFNIPAITQAG
QAKGCFVGFDLAHAVGNVELHLHDWGVDFACWCSYKYLNSGAGGLGGAFVHEKHAHTVKP
TLVGWFGHELSTRFKMDNKLQLIPGVSGFRISNPPILLVCSLHANLEIFKQATLKALRRK
SILLTGYLEYLIKLYCSKKKAEIKGPVVNIITPSHIEERGCQLTLAFPRSQKDVFEELQK
RGVVCDKREPHGIRVAPVPLYNSFHDVYKFVKLLTSVLDSA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcacttcctgagctaccagctgacagagtacaacacattgcagctgaactc
agatgtcacccaacagatgagaaggtcgccctcctcctagatgaggaagacgtgctaagg
cgtttcagggagtatttctatattcccaaaatgaaggatctgcctccaattgatttatct
ttagtgaataagaatgatgatgccatctacttcttgggacattctcttggccttcaacca
aaaatggttaaaacatatcttgaagaagaattagataagtgggccaaaataggagcctat
ggtcatgatgtaggaaaacgtccttggattataggagatgagagtattgtaggccttatg
aaggacattgtaggagccagtgagaaagaaatagccttaatgaatgctttgagtgttaac
ttacatctcctactgttatcattttttaaacccacacccaaacggcataaaattcttcta
gaagccaaagccttctcttctgatcattatgctattgagtcacagcttcaacttcatgga
cttgatgttgagaaaagtatgcggatgataaagccaagagagggagaagaaatcttgaga
atggaggatattcttgaagtaattgagaaggaaggagactcgattgcagtgatcctgttc
agcggggtgcatttttacactggacagctctttaacattcctgccattacacaagctgga
caagcaaagggttgttttgttggctttgatctagcacatgcagttggaaatgttgaactc
cacttacatgactggggagttgattttgcctgttggtgttcctacaagtacttaaattca
ggggcaggaggtcttggtggtgcctttgtacatgaaaagcatgcccatacagttaagccc
acgttagtgggatggtttggtcatgaactgagcaccagatttaaaatggataataagctg
cagttaatccctggggtcagtggattccgaatttccaatcctcccattttgctggtctgt
tccttgcatgccaatttggagatctttaagcaagcaactttaaaagcattgaggagaaaa
tccattttgttaactggttatctggaatacctgatcaagctttactgtagcaaaaagaaa
gcagaaatcaagggaccagttgtgaacataattacaccatcccatatagaggagcggggc
tgccagttaacactagcgtttcctagatcccaaaaagatgtttttgaagaactacaaaaa
agaggcgtggtgtgtgacaagagagaaccccatggcattcgagtggctccagtgcctctc
tacaattcttttcatgatgtttataagtttgtcaagttgctcacttctgtacttgattct
gcataa

DBGET integrated database retrieval system