KEGG   Heterocephalus glaber (naked mole rat): 101706114Help
Entry
101706114         CDS       T02812                                 

Gene name
Sirt6
Definition
(RefSeq) sirtuin 6
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04714  Thermogenesis
hgl05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    101706114 (Sirt6)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101706114 (Sirt6)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101706114 (Sirt6)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     101706114 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 101706114
NCBI-ProteinID: NP_001297193
UniProt: G5BZB2
Position
Un
AA seq 350 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPKELELKVWELARLVWQSSNVVFHTGAGISTSSG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTRTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRFCTVAKARGLRACRGE
LRDTILDWEDALPERDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRQADLRIHGYVDDVMAGLMRHLGLDIPAWHGPRVLERALPPLPRPPAPKLEQK
DDKGEDSTAQLNGSAPTQPKPEPSSPKLERPESLAPCRPPKRLKAEAVPS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaactacgcggcggggctgtcgccgtatgcggataagggcaagtgtggcctc
cccgagatttttgaccccccgaaggagttggagctgaaggtgtgggagctggccaggctg
gtgtggcagtcctccaatgtggtgttccacacaggcgctggcatcagtacttcctcaggc
atccctgacttcaggggcccgcacggtgtgtggaccatggaggagcggggtctggcgccc
aagttcgacacgacctttgagagcgcgcggcccacgcgcacacacatggcgctggtgcag
ctggagcgcgtggggctgctgcacttcctcgtcagccagaacgtggacgggctgcatgtg
cgctccggcttccccagggacaaactggcagagctgcatgggaacatgttcgtagaagaa
tgtgccaagtgtaagacgcagtacgtccgggacacggtcgtgggcaccatgggcctcaag
gccaccgggaggttctgcacagtggccaaggcgcggggactgcgggcttgccggggggag
ctgagagacaccatcctggactgggaagatgccctgcctgagcgggatctggctctcgcc
gacgaggccagcaggaacgcggacctgtccatcaccctggggacctccctgcagatccgg
cccagcgggaacctgcccctggccaccaaacgccggggcggccgcctggtcattgtgaac
ctgcagcccaccaagcacgaccgccaggctgacttgcgcatccacggctacgtggacgat
gtgatggctgggctcatgcgacacctggggctggacatccccgcctggcacgggccccga
gtgctggaaagggcccttcccccactgccccggcctcccgcacccaagctggagcagaag
gatgacaagggtgaggactctacagcccagctcaatggctctgcgcccacccagcccaag
ccagagcccagcagccccaaactggagcggcccgagagcctggccccttgcaggcccccc
aagaggctgaaggctgaggcagtgcccagctga

DBGET integrated database retrieval system