KEGG   Heterocephalus glaber (naked mole rat): 101706114Help
Entry
101706114         CDS       T02812                                 

Gene name
Sirt6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101706114 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 350 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPKELELKVWELARLVWQSSNVVFHTGAGISTSSG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTRTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRFCTVAKARGLRACRGE
LRDTILDWEDALPERDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRQADLRIHGYVDDVMAGLMRHLGLDIPAWHGPRVLERALPPLPRPPAPKLEQK
DDKGEDSTAQLNGSAPTQPKPEPSSPKLERPESLAPCRPPKRLKAEAVPS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaactacgcggcggggctgtcgccgtatgcggataagggcaagtgtggcctc
cccgagatttttgaccccccgaaggagttggagctgaaggtgtgggagctggccaggctg
gtgtggcagtcctccaatgtggtgttccacacaggcgctggcatcagtacttcctcaggc
atccctgacttcaggggcccgcacggtgtgtggaccatggaggagcggggtctggcgccc
aagttcgacacgacctttgagagcgcgcggcccacgcgcacacacatggcgctggtgcag
ctggagcgcgtggggctgctgcacttcctcgtcagccagaacgtggacgggctgcatgtg
cgctccggcttccccagggacaaactggcagagctgcatgggaacatgttcgtagaagaa
tgtgccaagtgtaagacgcagtacgtccgggacacggtcgtgggcaccatgggcctcaag
gccaccgggaggttctgcacagtggccaaggcgcggggactgcgggcttgccggggggag
ctgagagacaccatcctggactgggaagatgccctgcctgagcgggatctggctctcgcc
gacgaggccagcaggaacgcggacctgtccatcaccctggggacctccctgcagatccgg
cccagcgggaacctgcccctggccaccaaacgccggggcggccgcctggtcattgtgaac
ctgcagcccaccaagcacgaccgccaggctgacttgcgcatccacggctacgtggacgat
gtgatggctgggctcatgcgacacctggggctggacatccccgcctggcacgggccccga
gtgctggaaagggcccttcccccactgccccggcctcccgcacccaagctggagcagaag
gatgacaagggtgaggactctacagcccagctcaatggctctgcacccacccagcccaag
ccagagcccagcagccccaaactggagcggcccgagagcctggccccttgcaggcccccc
aagaggctgaaggctgaggcagtgcccagctga

DBGET integrated database retrieval system