KEGG   Heterocephalus glaber (naked mole rat): 101706346Help
Entry
101706346         CDS       T02812                                 

Gene name
Rnase1
Definition
ribonuclease, RNase A family, 1 (pancreatic)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     101706346 (Rnase1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 156 aa AA seqDB search
MALEKSLVLFPLLVLVLLGLVCVQPSLGKESSAMKFRRQHMDSEGSPNTNANYCNEMMRR
RNMTEGRCKPVNTFVHEPLADVQAVCFQKNVACKNGQTNCYQSSSSMHITDCRLTSNSKY
PTCSYRTSQMERSIIVACEGNPYVPVHFDASVESST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaagtccctggtcctcttcccactacttgtcctggtgctcctggggctg
gtgtgtgtccagccttccctgggcaaagaatcctctgccatgaagttccggcggcagcac
atggactcagagggttcccccaacaccaacgccaactactgcaatgaaatgatgagacgc
aggaatatgacggagggacgctgcaagcccgtgaacacctttgtgcatgagcccctagca
gatgtccaggctgtctgcttccagaaaaatgtcgcctgcaaaaatgggcagaccaactgc
taccagagcagctccagcatgcacatcacagactgccgcctgacgagcaactccaagtac
cccacctgctcctaccgcaccagccagatggagaggagcatcatcgtggcctgtgagggg
aacccgtatgtgccagtccacttcgatgcttctgtggagtcctccacctaa

DBGET integrated database retrieval system