KEGG   Heterocephalus glaber (naked mole rat): 101706441Help
Entry
101706441         CDS       T02812                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hgl00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 363 aa AA seqDB search
MASKSWLNFLTFLCGSAKGFFLCSQLFSILLGEQGHTQPNILHNDPHARHSDDDGQNHLE
GQMNFNADSRQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKTTWGQHCNKVLF
MSSEENKDFPTVGLKTKEGRDQLYWKTIKAFQCVHDHYLEDADWFMKADDNTYVILDNLR
WLLSKYSPENPIYFWRRFKPFVKQGYMSGGAGYVLSKEALKRFIEAFKTEKCTHSSSIED
LALGKCMEVMNVEAGDSRDTTGKETFHPFVPEHHLIKNYLPRTSWYWNYNYYPPVQGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRAYGYLYRYQPALPENILKEVSQVNKNEDPKVKL
GNP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctctgtggatcagcaaaaggattt
tttttatgttctcagctatttagtattttgttgggagaacaaggtcacacccagcctaat
attcttcataatgatcctcatgcaagacattcagatgatgatggacagaatcatctagaa
ggacaaatgaacttcaatgcagattctaggcaacataaagatgagaacacagacatcgct
gaaaacctgtaccagaaagttaaaattctttgttgggttatgacgggccctcaaaatcta
gagaaaaaggccaaacatgtcaaaactacatggggccaacattgtaataaagtgttattt
atgagttcagaagaaaataaagacttccctactgtgggattaaaaaccaaagaaggtaga
gatcaactatactggaaaacaattaaagcttttcagtgtgttcatgaccattatttagaa
gatgcggattggtttatgaaagcagatgacaatacatatgttatactagacaatttgaga
tggcttctttcaaaatatagccctgaaaaccccatttatttttggagaaggtttaagccc
tttgtaaagcagggttacatgagtggaggagcaggatatgtactaagcaaagaagccttg
aagagatttattgaggcatttaaaacagaaaaatgtacacatagttcttccatcgaagac
ctagcactgggaaaatgcatggaagttatgaatgtagaagctggggattccagagatacc
acaggaaaagaaacttttcatccctttgtaccagaacaccacttaatcaaaaattatcta
cccagaacctcttggtactggaattataactattatcctcctgtacagggccctggttgc
tgttctgatcttgcagtttcttttcactatgttgattctacaaccatgtatgaattagaa
tacctcgtttatcatcttcgtgcatatggttatttgtatagatatcaacctgccttacct
gagaacatactaaaggaagtaagtcaagtaaacaaaaatgaagatccaaaagtaaaatta
gggaacccttga

DBGET integrated database retrieval system