KEGG   Heterocephalus glaber (naked mole rat): 101707055Help
Entry
101707055         CDS       T02812                                 

Gene name
Pik3cg
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hgl00562]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hgl04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hgl04015]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hgl04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hgl04370]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hgl04630]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hgl04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hgl04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hgl04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hgl04070]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hgl04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hgl04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hgl04810]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hgl04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:hgl04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hgl04620]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hgl04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hgl04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hgl04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hgl04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hgl04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hgl04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hgl04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hgl04910]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hgl04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hgl04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hgl04917]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hgl04921]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hgl04919]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hgl04261]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hgl04973]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hgl04960]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hgl04725]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hgl04722]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hgl04750]
Organismal Systems; Development; Osteoclast differentiation [PATH:hgl04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hgl05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hgl05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hgl05203]
Human Diseases; Cancers; Colorectal cancer [PATH:hgl05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:hgl05212]
Human Diseases; Cancers; Glioma [PATH:hgl05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hgl05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hgl05220]
Human Diseases; Cancers; Melanoma [PATH:hgl05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hgl05211]
Human Diseases; Cancers; Prostate cancer [PATH:hgl05215]
Human Diseases; Cancers; Endometrial cancer [PATH:hgl05213]
Human Diseases; Cancers; Small cell lung cancer [PATH:hgl05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hgl05223]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hgl04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hgl04932]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hgl05100]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hgl05166]
Human Diseases; Infectious diseases; Measles [PATH:hgl05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hgl05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hgl05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hgl05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hgl05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hgl05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hgl05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hgl05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1102 aa AA seqDB search
MELENSEPPVILREDNLRRRRRMKPRSAASSLSSTELVPIEFVLPTSQRHSKTPETVLLH
VAGHGNVEQMKAQVWFRALETSAAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLQYWKVLHQSPGQIHLVQRHAPSEETLAFQRQLTALIGYDVTDVSNVHDDELESARRRL
VTPRMAEVASRDARLYSMHPWVTSKPLPEYLSKKITNNCIFIVIHRSTTSQTIKVSADDT
PASILQSFFAKMARKKSLMDIPESQSEQDFVLRVCGRDEYLVGDTPIKNFQWLRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRN
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSAKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLEIYCGKAPGQSGKSPAETPGSESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQIPGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEEIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGE
QETVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLQDLAQQVHVIEMLQRVTIDIKSLSAEKYDVSAQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDSKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactctgagcctcctgtgatcctgagggaggacaacctccgccggcgt
cggaggatgaagccgcgcagcgcggcctccagcctgtcctccacagagctcgtacccatt
gagttcgtgctgcccaccagccagcgccacagcaagacccctgaaaccgtgctgctgcac
gtggcgggccacggcaacgtggagcagatgaaagcccaggtgtggtttcgcgcgctggag
accagcgcagcagccgacttctaccaccgcctgggcccggaccacttcctcctgctgtac
cagaagaagggccagtggtatgagatctacgataagtaccaggtggtgcagaccttggac
tgcctgcaatattggaaggtgctgcaccagagccccgggcagatccacctggtgcagcgg
cacgccccctcggaggagacgctggccttccagcggcagctcacggcgctcattggctac
gacgtcacggacgtcagcaacgtgcacgacgacgagctggagtccgcgcgccgccggctg
gtgacgccgcgcatggccgaggtggccagccgcgacgccaggctctactctatgcacccc
tgggtgacatccaagcccctcccggagtacctgtccaagaagatcaccaacaactgtatc
ttcatcgtcatccaccgcagcactaccagccagaccatcaaggtctcggctgacgacacc
cccgccagcatcctccagagcttcttcgccaagatggccaggaagaagtcgctaatggac
atccccgagagccagagcgagcaggacttcgtgctgcgcgtctgcggccgggatgaatac
ctggtgggggacacccccatcaaaaacttccagtggttgaggcactgcctcaaaaatgga
gaagagatccacctggtgctggacacgcccccggacccagccttggacgaggtaaggaaa
gaggagtggcccctcgtggatgactgcacgggtgtcaccggctaccatgagcagctgacc
atccacggcaaggaccacgagagcgtgttcaccgtgtccttgtgggactgtgaccggaac
ttcagggtcaagatcagaggcatcgacatccccgtcctgccccggaacgcggacctcaca
gtttttgtggaagccaacatccagcatgggcagcaggtcctttgccaacggcgaaccagt
gccaaacccttcacagaggaggtgctctggaacgtgtggcttgagttcagcatcaaaatc
aaggacttgcccaagggggctctgctgaacctcgagatctactgcggcaaagctccgggg
cagtcgggcaagtcccctgcagaaacccccggctccgaatccaggggcaaagctcagctt
ctctactacgtgaacctgctgctgatagaccaccgcttcctcctgcgacacggggagtac
gtgctgcacatgtggcagatacccgggaagggagaagaccaagggagcttcaatgcggac
aagctcacctccgcaactaacccagacaaggagaactcaatgtccatctccatccttctg
gacaattactgtcacccaatagcactccctaagcatcagcccacccctgaccctgaaggg
gaccgagtgcgagccgaaatgcccaaccagcttcgaaagcaactggaagagatcatagct
actgatccactcaatcctctcacagcagaggacaaagaactgctctggcactttagatat
gaaagcctgaagcacccaaaagcatatcctaagctgttcagctcagtgaagtggggagag
caagaaacagtggccaaaacataccaactgttagccaggagggagatctgggatcagagt
gctttggatgttgggttaacgatgcaacttctggactgcaacttttcagatgaaaacgtc
agagccattgcagttcagaagctggagagcttggaggacgatgatgttttgcattacctt
ctgcagctggtgcaggctgtgaaatttgaaccctaccatgacagtgccctggccaggttt
ctgctgaagcgcggcttaagaaacaaaagaatcggtcacttcttgttttggttcttgaga
agtgagatagcacagtccagacactatcagcagaggtttgccgtcatcctggaagcctat
ctgaggggctgtggcaccgccatgctgcaggacttggcccagcaggtccacgtcattgag
atgctgcaaagggtcaccattgacatcaaatccctctctgctgagaagtacgacgtcagt
gcccaggttatttcacagcttaagcaaaagcttgaaaacctacagaattcgaatctccca
aagagctttagagttccatatgatcctggactgaaagcaggaactctggtgattgagaag
tgtaaagtgatggcctctaagaagaagcccctgtggctggaatttaaatgtgctgacccc
accgctctatccaatgagacaattggaattatctttaaacacggagatgatctgcgccaa
gacatgcttatcttacagattctacgaatcatggagtccatttgggagactgaatctttg
gatttgtgcctcctgccatatggttgcatttcaactggggacaaaataggaatgatagag
atcgtgaaagacgccaccaccattgccaaaattcagcaaagcaccgtgggcaacaccggc
gcattcaaagatgaagtcctgaatcactggctcaaagaaaaatgcccgattgaagaaaag
tttcaggcagcagtggagagatttgtttactcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacaggcacaacgacaatattatgatctcagagacaggtaaccta
ttccatattgactttgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctgaccccagacttcttgtttgtgatgggaacttccgggaag
aaaacgagtctgcacttccagaaatttcaggatgtctgtgtgaaggcttatctggccctc
cgccatcacacaaacctcctgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagtaaagaagatatcgaatatatccgggatgccctgacagttgggaaaagc
gaggaggattccaagaagtatttcctggatcagattgaagtttgtagagacaaaggatgg
acagtgcagttcaattggttcctacatcttgttcttggcatcaaacaaggagagaaacac
tcagcctaa

DBGET integrated database retrieval system