KEGG   Heterocephalus glaber (naked mole rat): 101707055Help
Entry
101707055         CDS       T02812                                 

Gene name
Pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101707055 (Pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101707055 (Pik3cg)
   04072 Phospholipase D signaling pathway
    101707055 (Pik3cg)
   04022 cGMP - PKG signaling pathway
    101707055 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    101707055 (Pik3cg)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101707055 (Pik3cg)
  Endocrine system
   04921 Oxytocin signaling pathway
    101707055 (Pik3cg)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101707055 (Pik3cg)
  Nervous system
   04725 Cholinergic synapse
    101707055 (Pik3cg)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    101707055 (Pik3cg)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101707055 (Pik3cg)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101707055 (Pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1102 aa AA seqDB search
MELENSEPPVILREDNLRRRRRMKPRSAASSLSSTELVPIEFVLPTSQRHSKTPETVLLH
VAGHGNVEQMKAQVWFRALETSAAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLQYWKVLHQSPGQIHLVQRHAPSEETLAFQRQLTALIGYDVTDVSNVHDDELESARRRL
VTPRMAEVASRDARLYSMHPWVTSKPLPEYLSKKITNNCIFIVIHRSTTSQTIKVSADDT
PASILQSFFAKMARKKSLMDIPESQSEQDFVLRVCGRDEYLVGDTPIKNFQWLRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRN
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSAKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLEIYCGKAPGQSGKSPAETPGSESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQIPGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEEIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGE
QETVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLQDLAQQVHVIEMLQRVTIDIKSLSAEKYDVSAQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDSKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactctgagcctcctgtgatcctgagggaggacaacctccgccggcgt
cggaggatgaagccgcgcagcgcggcctccagcctgtcctccacagagctcgtacccatt
gagttcgtgctgcccaccagccagcgccacagcaagacccctgaaaccgtgctgctgcac
gtggcgggccacggcaacgtggagcagatgaaagcccaggtgtggtttcgcgcgctggag
accagcgcagcagccgacttctaccaccgcctgggcccggaccacttcctcctgctgtac
cagaagaagggccagtggtatgagatctacgataagtaccaggtggtgcagaccttggac
tgcctgcaatattggaaggtgctgcaccagagccccgggcagatccacctggtgcagcgg
cacgccccctcggaggagacgctggccttccagcggcagctcacggcgctcattggctac
gacgtcacggacgtcagcaacgtgcacgacgacgagctggagtccgcgcgccgccggctg
gtgacgccgcgcatggccgaggtggccagccgcgacgccaggctctactctatgcacccc
tgggtgacatccaagcccctcccggagtacctgtccaagaagatcaccaacaactgtatc
ttcatcgtcatccaccgcagcactaccagccagaccatcaaggtctcggctgacgacacc
cccgccagcatcctccagagcttcttcgccaagatggccaggaagaagtcgctaatggac
atccccgagagccagagcgagcaggacttcgtgctgcgcgtctgcggccgggatgaatac
ctggtgggggacacccccatcaaaaacttccagtggttgaggcactgcctcaaaaatgga
gaagagatccacctggtgctggacacgcccccggacccagccttggacgaggtaaggaaa
gaggagtggcccctcgtggatgactgcacgggtgtcaccggctaccatgagcagctgacc
atccacggcaaggaccacgagagcgtgttcaccgtgtccttgtgggactgtgaccggaac
ttcagggtcaagatcagaggcatcgacatccccgtcctgccccggaacgcggacctcaca
gtttttgtggaagccaacatccagcatgggcagcaggtcctttgccaacggcgaaccagt
gccaaacccttcacagaggaggtgctctggaacgtgtggcttgagttcagcatcaaaatc
aaggacttgcccaagggggctctgctgaacctcgagatctactgcggcaaagctccgggg
cagtcgggcaagtcccctgcagaaacccccggctccgaatccaggggcaaagctcagctt
ctctactacgtgaacctgctgctgatagaccaccgcttcctcctgcgacacggggagtac
gtgctgcacatgtggcagatacccgggaagggagaagaccaagggagcttcaatgcggac
aagctcacctccgcaactaacccagacaaggagaactcaatgtccatctccatccttctg
gacaattactgtcacccaatagcactccctaagcatcagcccacccctgaccctgaaggg
gaccgagtgcgagccgaaatgcccaaccagcttcgaaagcaactggaagagatcatagct
actgatccactcaatcctctcacagcagaggacaaagaactgctctggcactttagatat
gaaagcctgaagcacccaaaagcatatcctaagctgttcagctcagtgaagtggggagag
caagaaacagtggccaaaacataccaactgttagccaggagggagatctgggatcagagt
gctttggatgttgggttaacgatgcaacttctggactgcaacttttcagatgaaaacgtc
agagccattgcagttcagaagctggagagcttggaggacgatgatgttttgcattacctt
ctgcagctggtgcaggctgtgaaatttgaaccctaccatgacagtgccctggccaggttt
ctgctgaagcgcggcttaagaaacaaaagaatcggtcacttcttgttttggttcttgaga
agtgagatagcacagtccagacactatcagcagaggtttgccgtcatcctggaagcctat
ctgaggggctgtggcaccgccatgctgcaggacttggcccagcaggtccacgtcattgag
atgctgcaaagggtcaccattgacatcaaatccctctctgctgagaagtacgacgtcagt
gcccaggttatttcacagcttaagcaaaagcttgaaaacctacagaattcgaatctccca
aagagctttagagttccatatgatcctggactgaaagcaggaactctggtgattgagaag
tgtaaagtgatggcctctaagaagaagcccctgtggctggaatttaaatgtgctgacccc
accgctctatccaatgagacaattggaattatctttaaacacggagatgatctgcgccaa
gacatgcttatcttacagattctacgaatcatggagtccatttgggagactgaatctttg
gatttgtgcctcctgccatatggttgcatttcaactggggacaaaataggaatgatagag
atcgtgaaagacgccaccaccattgccaaaattcagcaaagcaccgtgggcaacaccggc
gcattcaaagatgaagtcctgaatcactggctcaaagaaaaatgcccgattgaagaaaag
tttcaggcagcagtggagagatttgtttactcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacaggcacaacgacaatattatgatctcagagacaggtaaccta
ttccatattgactttgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctgaccccagacttcttgtttgtgatgggaacttccgggaag
aaaacgagtctgcacttccagaaatttcaggatgtctgtgtgaaggcttatctggccctc
cgccatcacacaaacctcctgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagtaaagaagatatcgaatatatccgggatgccctgacagttgggaaaagc
gaggaggattccaagaagtatttcctggatcagattgaagtttgtagagacaaaggatgg
acagtgcagttcaattggttcctacatcttgttcttggcatcaaacaaggagagaaacac
tcagcctaa

DBGET integrated database retrieval system