KEGG   Heterocephalus glaber (naked mole rat): 101707148Help
Entry
101707148         CDS       T02812                                 

Gene name
Gpd1l
Definition
glycerol-3-phosphate dehydrogenase 1-like
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101707148 (Gpd1l)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101707148 (Gpd1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 351 aa AA seqDB search
MAATPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDH
ENVKYLPGHKLPENVVAISNLSEAVQDADLLVFVIPHQFIHRICDELTGRVPKKALGITL
IKGIDEGPEGLKLISDIIREKMGIDISVLMGANIASEVAADKFCETTIGSKIMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRSGDNTKAAVIRLGLMEMISF
AKIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKEMLNGQKLQ
GPQTSAEVYRILKQKGLTDKFPLFTAVYQICYEGRPISEMLSCLQSHPEHT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgacgccgctgaaagtgtgcatcgtgggctccgggaactggggttcagctgtt
gcaaaaataattggtaataatgtcaagaaactgcagaagtttgcctccacagtcaagatg
tgggtctttgaagaaacagtcaatgggcgaaaattgacagacatcataaataatgaccat
gaaaatgtaaaatatctccctggacacaagctgccagaaaatgtggttgccatctctaac
ctcagtgaggctgtacaggatgcagacctgctggtgttcgtcatcccacaccagttcatt
caccggatctgcgatgagctcactggcagggtgcccaagaaagcactgggaatcaccctc
atcaagggcatcgacgagggcccagaggggctgaaactcatttctgacatcatccgtgag
aagatgggcattgacatcagtgtgctgatgggtgccaacattgccagcgaggtggctgca
gacaagttctgtgagaccaccatcggcagcaaaatcatggagaatgggcttctcttcaaa
gaacttctgcagactcccaattttcgaattactgtggttgatgatgcggacaccgttgaa
ctttgtggtgctcttaagaacatcgtcgccgtgggagctgggttctgcgatggcctccgc
agcggtgacaacaccaaagctgccgtcatccgcctgggcctcatggaaatgatctctttc
gccaagatcttctgcaagggccaggtgtccacagccaccttcctggagagctgtggggtg
gccgacctgatcaccacctgctatggagggcggaatcgcagggtggctgaggcattcgcc
agaacggggaagaccattgaagaattggagaaggagatgctaaacgggcagaagctccaa
ggacctcagacttcagcagaagtataccgcatcctcaaacagaaaggactcactgacaag
tttccactgtttaccgcagtgtatcagatctgctatgaaggcagacccatctcagagatg
ctgtcctgtctccagagccatccagagcacacctaa

DBGET integrated database retrieval system