KEGG   Heterocephalus glaber (naked mole rat): 101707823Help
Entry
101707823         CDS       T02812                                 

Gene name
Ugt1a6
Definition
UDP glucuronosyltransferase 1 family, polypeptide A6
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101707823 (Ugt1a6)
   00053 Ascorbate and aldarate metabolism
    101707823 (Ugt1a6)
   00500 Starch and sucrose metabolism
    101707823 (Ugt1a6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101707823 (Ugt1a6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101707823 (Ugt1a6)
   00860 Porphyrin and chlorophyll metabolism
    101707823 (Ugt1a6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101707823 (Ugt1a6)
   00982 Drug metabolism - cytochrome P450
    101707823 (Ugt1a6)
   00983 Drug metabolism - other enzymes
    101707823 (Ugt1a6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101707823 (Ugt1a6)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101707823 (Ugt1a6)
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101707823 (Ugt1a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MATALQAPLGGLVRLLLLVCVMSWAECGKVLVVPMEGSHWLSMKDVVRKLHAAGHQAEVL
APEVTVHVKGEDFFTLKTYTFPYSEEEYNHLMLSLIKLTFETQNFLKTFLKMMEIFTNVS
ETYERSCVEMLHDHSLIRQLNSSSFDVVLTDPVFPCGAILAKYLHIPAVFFLRGLPCSLD
FAGSQCPNPSSYIPQLLTTYSDHMSFLQRVKNMLYPLALNLFCSTVFGPYPRIASELFQR
EVSLVDVLSHASLWLFRGDFVLDYPRPIMPNMVFIGGINCVSRKPLSQEFEGYVNASGEH
GIVVFSLGSMISDIPEKKAMAIAEGLGKVPQTVLWRYTGTPPSNLAKNTILVKWLPQNDL
LGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTS
DDLANALKKVIYDKSYKENILRLSTLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAITLSVSFITLKCCAYGFRKCFGKKEHVKKTPKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcactgcaggcgcctctgggagggctggtgaggctgcttctcttggtgtgt
gtgatgtcgtgggctgagtgtgggaaggtgctggtggtccccatggagggcagccactgg
ctcagcatgaaggacgttgtgaggaagctccatgctgcaggacaccaggctgaggtcctg
gccccagaagtcacagtgcacgtgaaaggagaggacttcttcaccctgaaaacctacact
ttcccctacagcgaggaagaatacaatcaccttatgttgagcctcattaaattgacattt
gaaacacagaattttctgaagacatttttaaaaatgatggaaatcttcacaaatgtttca
gagacctatgagaggtcttgtgtggagatgttgcatgaccattcgctgatcagacaacta
aattccagctcctttgatgtggttttaacggaccctgtttttccttgtggggcaatactg
gctaagtatctgcatattcctgctgtctttttcctgcggggcttgccatgtagccttgac
tttgctggctcacagtgccccaacccttcttcctatattcctcagttgctcacaacatac
tctgaccatatgagtttcctgcagagagtcaagaacatgctctatcctctggccttgaac
ttgttttgcagcaccgtttttgggccttacccaaggatcgcctctgagctgttccagaga
gaagtgtctctggtggatgttctcagccatgcttccttgtggctgttcagaggggacttt
gtgttggactaccccaggcccatcatgcccaacatggtcttcatcgggggcatcaactgt
gtcagcaggaagccgctctcacaggaatttgaaggttatgttaatgcttctggagaacat
ggaattgtggttttctctttgggatccatgatttcagacattccggaaaagaaagctatg
gccattgctgagggtttgggcaaagttcctcaaacggtcctgtggcgctacactggaact
ccaccatcaaatcttgcaaagaatacgatccttgtgaagtggttaccccagaatgatctg
cttggtcacccaaagacccgggcgtttatcacacattctggctcccacggtatctatgaa
ggaatatgcaatggtgtccccatggtcatgatgcccttgtttggggatcagatggacaat
gcaaagcgcatggagacacggggagctggtgtgaccttgaatgtccttgaaatgacttct
gatgatttagcaaatgctctaaaaaaggtcatctatgacaaaagctacaaggagaacatc
ctgcgcctctccaccctgcacaaggaccgacccatagagccactggacctggctgtgttc
tgggtggaattcgtgatgaggcacaagggggcgccacacctgcgccctgcagcccacgac
ctcacctggtaccagtaccactccttggacgtgatcggcttcctcctggccattacgctg
tctgtgtccttcatcaccctcaagtgttgcgcctatggcttccggaaatgctttgggaaa
aaggagcatgtgaagaaaaccccaaaatccaagacacattga

DBGET integrated database retrieval system