KEGG   Heterocephalus glaber (naked mole rat): 101708253Help
Entry
101708253         CDS       T02812                                 

Gene name
Ncoa3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101708253 (Ncoa3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101708253 (Ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1429 aa AA seqDB search
MSGLGENPLDPLATDTRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAVSSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVSWTKETQRQKSHTFNCRMLIKTTHDVLEDMSTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPMYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPGPVGQGIRPPAAGCSSSVGSLSMSQNQGLQMLSSRAYGL
GDPSTTGQLSGARYGASSNIASLTAGPGMQSPSSYQNNTYGLNMSSPTHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHNFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNLTQPSKVSSQDSKSPLGLYCDQNPVESTMCQSNSRDHLNDKESK
ESSGEGAENQKGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSIIACGEG
TVKQEQLSPKKKENNALLRYLLDRDDPSDTLCKELQPQVEGMNNKTSQCSSSTIPSSTQE
KDPKIKTETSEEGSGDLDNLDAILGDLSSSDFYNNPISTNGSHLGSKQQMFQGTNSLAGL
RSPQSVQSIRPPYSRAVSLDSPVTVGSSPPIKNISAFPMLPKQPMLGGTPRMMDSQENYG
SNMGGPNRNATVSQTPTSGDWGLPNSKASRMEPVSSNSMGRPGGDYSASLPSSLPRPSMG
SAMPALPLRSNNIPSARPVLLQQQHQQQEQQQQLQMKPGEIAMGMGVNPYGQAAPSSQPG
SWPDGMLSMEQGPHATQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATG
LEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAALYGQTYPTQGPPMQGGFNL
QGQSPSFNSMMNQMSQQGSFPLQGMHARANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSR
QALEMKMENPTGGAAAVMRPMMQPQQGFLNAQMVAQRSRELLSHHFRQQRVVMMMQQQQQ
QQQQQSQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPPNYGMGQQPDPAFGRVPSP
PNAMMSSRMGPSQNPVMQHPQTAPMYQSSEMKGWPSGNLARNSSFPQQQFAHQGNPAAYG
MVHMNGSSGHLGQMNMNSMPMSGMPMGPDQVWGSISSCSLKRIKVSPVI
NT seq 4290 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaaccctttggatccactggccactgatacacgaaaacgcaaa
ttaccatgtgatactccagggcagggtcttacctgcagtggtgaaaagtggagaagagaa
caggagagtaaatatatcgaagaattggctgaactgatatctgcaaatcttagtgatatt
gacaatttcaacgtcaaaccagataaatgtgcgattttaaaggaaacagtaagacaaata
cgtcaaataaaagagcaaggaaaagctgtttccagtgatgatgatgttcagaaagctgat
gtatcttctacaggacagggagttattgataaagactctttaggaccacttttacttcag
gcattggatggttttttgtttgtggtgaatcgagatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataaacaggaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagtttcctggacaaaggagacccagagacaaaagagccatacctttaattgtcgtatg
ttgataaaaacaacacacgatgttctagaagatatgagcaccagtcctgaaatgcgccag
agatatgaaacaatgcagtgctttgccttgtctcagccacgagctatgatggaggagggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattactacaggagaaagagca
tttccatcaagtcctgagagctttattactagacatgatctttcaggaaaggttgttaat
atagatacaaattcactaagatcctccatgaggcctggctttgaagatataatccgaagg
tgtattcagaggttttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatattcatggccatgcagaaaccccaatgtatcgattttcgttggctgat
ggaactatagtgactgcacaaacaaaaagtaaactcttccgaaatcctgtaacaaatgat
cgtcatggttttgtctcaactcactttcttcagagagaacagaatgggtatagaccaaac
ccaggtcctgtaggacaaggcattagacctcctgctgctggatgcagcagttcggtaggc
agcttgagcatgtcacaaaatcaaggcttacagatgctgagcagcagggcctacggcttg
ggagaccccagcaccacagggcagctgagtggagctaggtatggtgcttccagtaacatt
gcttcactgacagctgggccaggcatgcagtcaccatcttcctaccaaaacaacacctat
gggctcaacatgagtagccccacacatggcagtcctggtcttggttccaaccagcagaat
attatgatttcacctcgtaatcgtgggagtccaaagatggcgtcacatcagttttctcct
gttgcaggagtacattctcccatgggatcttctggcaatacagggagccacaacttttcc
agcagctctctcagtgccctgcaagccattagtgagggtgtggggacttctcttttatct
actttgtcttcaccaggacccaaactggataactctcccaatatgaatttaacccaacca
agtaaagtgagcagtcaggattctaagagtcccttaggcttgtactgtgaccagaatcca
gtggagagtacaatgtgtcagtcaaatagcagagatcacctcaatgacaaagaaagtaag
gagagcagtggtgaaggggcagagaatcagaagggtcctttggaaagcaaaggtcataaa
aaattactgcagttactcacctgctcttctgatgaccgaggccattcctccttgaccagc
tcccccttggattcaagttgtaaagactcttccattagtgtcaccagcccctctggagtc
tcttcctcaacatctggaggagtgtcctccacatccaatatgcatgggtcactgttgcaa
gagaagcaccggattttgcataagttgctgcagaatgggaattcaccagctgaagtggcc
aagattactgcagaagccactggaaaagacaccagcagtataattgcttgtggggaagga
actgtcaagcaggagcagctgagtcctaagaagaaggagaataatgcacttctaagatac
ttgctggacagggatgatcccagtgatacactctgtaaagaattacagccccaagttgaa
ggaatgaataataaaacgagtcagtgcagcagctccactattcccagctcaactcaagag
aaagaccctaaaattaagacggaaacaagtgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgagtagttctgacttttacaataaccctatatcgacaaat
ggtagtcatctggggagcaagcaacagatgtttcaaggaactaattctctggcaggcttg
agaagtccacagtctgtgcagtccattcgtcctccatatagccgagcagtttctctagat
agccctgttaccgttggctcaagtcctccaataaagaatatcagtgctttccccatgtta
ccaaagcagcccatgttgggtgggactccaagaatgatggatagtcaggaaaattatggc
tcaaacatgggtggaccaaacagaaatgcaactgtgagccagactcctacctcaggagac
tggggcttaccaaattcaaaggccagcagaatggaacctgtgagttcaaactccatggga
agaccaggaggagattacagtgcttctttacccagttctttacccagaccatcaatggga
agtgctatgccagccttgcctcttcggtcaaataacataccaagtgcaaggccagtgttg
ctgcagcagcagcatcagcagcaggagcagcagcagcagcttcagatgaagcctggtgag
attgccatgggaatgggggtcaatccgtatggccaagcagcaccatctagtcaaccaggt
tcctggccagatggcatgctgtccatggaacagggccctcatgcaactcaaaatagacca
attcttaggaattctctggatgatctccttgggccaccttctaacctggaaggccagagt
gatgaaagagctctgttggaccagctgcacacactcttgagcaacacggatgcaacaggc
ctggaagaaattgaccgagctttgggaatcccagaacttgtgaatcagggacaagctttg
gagcccaaacaggatgctttccaaggccaggaagcagcagtaatgatggatcagaaggca
gcattgtatgggcagacatacccaacacaggggcctccaatgcagggaggctttaatctc
cagggacaatcaccatcttttaactctatgatgaatcagatgagccagcaaggcagtttt
cctctccaaggaatgcatgctagggccaacatcatgagaccccggacaaacacgccaaag
caacttagaatgcagcttcaacagagactgcagggccaacagttcttgaatcagagccgg
caggcacttgaaatgaagatggaaaaccccactggtggtgctgctgcagtgatgaggccc
atgatgcagccccagcagggttttctaaatgcccagatggttgcccagcgcagcagagag
ctgctaagtcatcacttccgacaacagagggtggtgatgatgatgcagcagcaacagcaa
cagcaacagcagcaaagtcaagccttcagcccacctccaaatgtgactgcttcccccagt
atggatggcgttttggcaggacctgcaatgccacaggctccaccacagcagtttccatac
ccaccaaattatggaatgggacaacaaccagatccagcctttggtcgagtgcccagtcct
cctaatgcaatgatgtcatcaagaatgggtccatcccagaaccctgtgatgcagcaccca
cagactgcacccatgtatcagtcctcagaaatgaagggctggccatcaggaaacttggcc
agaaacagctccttcccccagcagcagtttgcccaccaggggaatcctgcagcctatggt
atggtgcacatgaatggcagcagtggtcacttgggacagatgaacatgaactctatgccc
atgtcgggcatgcccatgggtcctgatcaggtatggggatctatttcttcttgttctctg
aagagaatcaaagtctcacctgtgatctaa

DBGET integrated database retrieval system