KEGG   Heterocephalus glaber (naked mole rat): 101708253Help
Entry
101708253         CDS       T02812                                 

Gene name
Ncoa3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101708253 (Ncoa3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101708253 (Ncoa3)
   05224 Breast cancer
    101708253 (Ncoa3)
  Drug resistance
   01522 Endocrine resistance
    101708253 (Ncoa3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101708253 (Ncoa3)
Chromosome [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101708253 (Ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1412 aa AA seqDB search
MSGLGENPLDPLATDTRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAVSSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVSWTKETQRQKSHTFNCRMLIKTTHDVLEDMSTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPMYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPGPVGQGIRPPAAGCSSSVGSLSMSQNQGLQMLSSRAYGL
GDPSTTGQLSGARYGASSNIASLTAGPGMQSPSSYQNNTYGLNMSSPTHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHNFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNLTQPSKVSSQDSKSPLGLYCDQNPVESTMCQSNSRDHLNDKESK
ESSGEGAENQKGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSIIACGEG
TVKQEQLSPKKKENNALLRYLLDRDDPSDTLCKELQPQVEGMNNKTSQCSSSTIPSSTQE
KDPKIKTETSEEGSGDLDNLDAILGDLSSSDFYNNPISTNGSHLGSKQQMFQGTNSLAGL
RSPQSVQSIRPPYSRAVSLDSPVTVGSSPPIKNISAFPMLPKQPMLGGTPRMMDSQENYG
SNMGGPNRNATVSQTPTSGDWGLPNSKASRMEPVSSNSMGRPGGDYSASLPSSLPRPSMG
SAMPALPLRSNNIPSARPVLLQQQHQQQEQQQQLQMKPGEIAMGMGVNPYGQAAPSSQPG
SWPDGMLSMEQGPHATQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATG
LEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAALYGQTYPTQGPPMQGGFNL
QGQSPSFNSMMNQMSQQGSFPLQGMHARANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSR
QALEMKMENPTGGAAAVMRPMMQPQGFLNAQMVAQRSRELLSHHFRQQRVVMMMQQQQQQ
QQQQSQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPPNYGMGQQPDPAFGRVPSPP
NAMMSSRMGPSQNPVMQHPQTAPMYQSSEMKGWPSGNLARNSSFPQQQFAHQGNPAAYGM
VHMNGSSGHLGQMNMNSMPMSGMPMGPDQKYC
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaaccctttggatccactggccactgatacacgaaaacgcaaa
ttaccatgtgatactccagggcagggtcttacctgcagtggtgaaaagtggagaagagaa
caggagagtaaatatatcgaagaattggctgaactgatatctgcaaatcttagtgatatt
gacaatttcaacgtcaaaccagataaatgtgcgattttaaaggaaacagtaagacaaata
cgtcaaataaaagagcaaggaaaagctgtttccagtgatgatgatgttcagaaagctgat
gtatcttctacaggacagggagttattgataaagactctttaggaccacttttacttcag
gcattggatggttttttgtttgtggtgaatcgagatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataaacaggaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagtttcctggacaaaggagacccagagacaaaagagccatacctttaattgtcgtatg
ttgataaaaacaacacacgatgttctagaagatatgagcaccagtcctgaaatgcgccag
agatatgaaacaatgcagtgctttgccttgtctcagccacgagctatgatggaggagggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattactacaggagaaagagca
tttccatcaagtcctgagagctttattactagacatgatctttcaggaaaggttgttaat
atagatacaaattcactaagatcctccatgaggcctggctttgaagatataatccgaagg
tgtattcagaggttttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatattcatggccatgcagaaaccccaatgtatcgattttcgttggctgat
ggaactatagtgactgcacaaacaaaaagtaaactcttccgaaatcctgtaacaaatgat
cgtcatggttttgtctcaactcactttcttcagagagaacagaatgggtatagaccaaac
ccaggtcctgtaggacaaggcattagacctcctgctgctggatgcagcagttcggtaggc
agcttgagcatgtcacaaaatcaaggcttacagatgctgagcagcagggcctacggcttg
ggagaccccagcaccacagggcagctgagtggagctaggtatggtgcttccagtaacatt
gcttcactgacagctgggccaggcatgcagtcaccatcttcctaccaaaacaacacctat
gggctcaacatgagtagccccacacatggcagtcctggtcttggttccaaccagcagaat
attatgatttcacctcgtaatcgtgggagtccaaagatggcgtcacatcagttttctcct
gttgcaggagtacattctcccatgggatcttctggcaatacagggagccacaacttttcc
agcagctctctcagtgccctgcaagccattagtgagggtgtggggacttctcttttatct
actttgtcttcaccaggacccaaactggataactctcccaatatgaatttaacccaacca
agtaaagtgagcagtcaggattctaagagtcccttaggcttgtactgtgaccagaatcca
gtggagagtacaatgtgtcagtcaaatagcagagatcacctcaatgacaaagaaagtaag
gagagcagtggtgaaggggcagagaatcagaagggtcctttggaaagcaaaggtcataaa
aaattactgcagttactcacctgctcttctgatgaccgaggccattcctccttgaccagc
tcccccttggattcaagttgtaaagactcttccattagtgtcaccagcccctctggagtc
tcttcctcaacatctggaggagtgtcctccacatccaatatgcatgggtcactgttgcaa
gagaagcaccggattttgcataagttgctgcagaatgggaattcaccagctgaagtggcc
aagattactgcagaagccactggaaaagacaccagcagtataattgcttgtggggaagga
actgtcaagcaggagcagctgagtcctaagaagaaggagaataatgcacttctaagatac
ttgctggacagggatgatcccagtgatacactctgtaaagaattacagccccaagttgaa
ggaatgaataataaaacgagtcagtgcagcagctccactattcccagctcaactcaagag
aaagaccctaaaattaagacggaaacaagtgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgagtagttctgacttttacaataaccctatatcgacaaat
ggtagtcatctggggagcaagcaacagatgtttcaaggaactaattctctggcaggcttg
agaagtccacagtctgtgcagtccattcgtcctccatatagccgagcagtttctctagat
agccctgttaccgttggctcaagtcctccaataaagaatatcagtgctttccccatgtta
ccaaagcagcccatgttgggtgggactccaagaatgatggatagtcaggaaaattatggc
tcaaacatgggtggaccaaacagaaatgcaactgtgagccagactcctacctcaggagac
tggggcttaccaaattcaaaggccagcagaatggaacctgtgagttcaaactccatggga
agaccaggaggagattacagtgcttctttacccagttctttacccagaccatcaatggga
agtgctatgccagccttgcctcttcggtcaaataacataccaagtgcaaggccagtgttg
ctgcagcagcagcatcagcagcaggagcagcagcagcagcttcagatgaagcctggtgag
attgccatgggaatgggggtcaatccgtatggccaagcagcaccatctagtcaaccaggt
tcctggccagatggcatgctgtccatggaacagggccctcatgcaactcaaaatagacca
attcttaggaattctctggatgatctccttgggccaccttctaacctggaaggccagagt
gatgaaagagctctgttggaccagctgcacacactcttgagcaacacggatgcaacaggc
ctggaagaaattgaccgagctttgggaatcccagaacttgtgaatcagggacaagctttg
gagcccaaacaggatgctttccaaggccaggaagcagcagtaatgatggatcagaaggca
gcattgtatgggcagacatacccaacacaggggcctccaatgcagggaggctttaatctc
cagggacaatcaccatcttttaactctatgatgaatcagatgagccagcaaggcagtttt
cctctccaaggaatgcatgctagggccaacatcatgagaccccggacaaacacgccaaag
caacttagaatgcagcttcaacagagactgcagggccaacagttcttgaatcagagccgg
caggcacttgaaatgaagatggaaaaccccactggtggtgctgctgcagtgatgaggccc
atgatgcagccccagggttttctaaatgcccagatggttgcccagcgcagcagagagctg
ctaagtcatcacttccgacaacagagggtggtgatgatgatgcagcagcaacagcaacag
caacagcagcaaagtcaagccttcagcccacctccaaatgtgactgcttcccccagtatg
gatggcgttttggcaggacctgcaatgccacaggctccaccacagcagtttccataccca
ccaaattatggaatgggacaacaaccagatccagcctttggtcgagtgcccagtcctcct
aatgcaatgatgtcatcaagaatgggtccatcccagaaccctgtgatgcagcacccacag
actgcacccatgtatcagtcctcagaaatgaagggctggccatcaggaaacttggccaga
aacagctccttcccccagcagcagtttgcccaccaggggaatcctgcagcctatggtatg
gtgcacatgaatggcagcagtggtcacttgggacagatgaacatgaactctatgcccatg
tcgggcatgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system