KEGG   Heterocephalus glaber (naked mole rat): 101708836Help
Entry
101708836         CDS       T02812                                 

Gene name
Srd5a2
Definition
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101708836 (Srd5a2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    101708836 (Srd5a2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101708836 (Srd5a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 254 aa AA seqDB search
MLVRCQESPVLAGSATLAILGLMILYFAQPSSYGKFSQTGAPGAQCLPARAAWFLQELPS
FAVPVGILFQQPRFLVGPPETVLLGLFCAHYFHRTFIYSFLTRGRPYPAVLLFQGIVFCI
GNGFLQSYYLIYCAEYPEEWFTDIRFSLGVFLFILGMGINIHSDHTLRQLRKPGEVTYRI
PQGGLFTYVSGANFLGEIIEWVGYALATWSLPGLAFAFFSLCFLGLRAFYHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctagttcggtgccaggagagcccagtactggcgggcagcgccactttggccatcttg
gggctaatgattctgtacttcgcgcagccctcgtcctacgggaagttcagccagacaggg
gcgcccggggctcagtgcctccccgcccgcgccgcctggttcctgcaggagctgccttcc
ttcgccgtcccggtagggatcctcttccagcagccccgcttcctagtcggaccgcccgag
actgtgcttctggggttattctgcgcacattactttcacaggacttttatttactcattt
ctcactagagggaggccttatccagcagtgctccttttccaaggaatagtcttctgcatc
ggaaatggattccttcaaagctactatctgatttactgtgcagaataccctgaagagtgg
ttcacagacatccggtttagcttgggtgtcttcctatttattttgggaatgggaatcaac
attcatagtgaccataccttgcgccagctcagaaagcctggagaggtcacctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagcaaatttccttggtgagatcattgaa
tgggttggctatgccttggccacttggtctcttccaggacttgcttttgcatttttctca
ctttgtttccttgggcttcgagctttttaccaccacaggttctacctcaagatgtttgag
gactaccctaaatctcggaaagccctcattccattcatcttttaa

DBGET integrated database retrieval system