KEGG   Heterocephalus glaber (naked mole rat): 101709289Help
Entry
101709289         CDS       T02812                                 

Gene name
Aldh1l1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hgl00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEIVGVFTIPDKDGKADPLGLEAKKDGVPVFKFPRWR
ARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVIDAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVEAV
RLISEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSDLVPEGEDLLIPGAHRPGMVTKAGLILFGNDDRMLLVKNIQLEDGKMI
PASHFFKGAASSALELTEAEVITAEAVRSAWQRILPSVPDIEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDEENECVIDYVEKAVNKLTLYI
PHQLFIGGMFVDAEGTKTYDAINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGCTIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMR
SCALSNVKKISLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVENSIH
DQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLKKLLEYCQHGMKEGATLICGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVLSRANATEFGLASGVFT
RDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgctgtgattggacaaagcctgtttggtcaggaagtttactgtcacctaagg
aaggagggtcatgagatagtgggcgtgttcaccatcccagacaaggatgggaaggctgac
cccctaggcctggaggctaagaaggatggagtgccagtgttcaagttcccacgatggcgg
gcacgaggacaagctctgcctgatgtggtggccaaataccaggctttgggtgccgagctc
aacgtcttgccattctgcagccagttcatccccatggaggtcattgatgctcctagacat
ggctccatcatctaccacccatctctgctccccaggcaccggggagcttcagccatcaac
tggacactcattcatggagataagaaagggggctttactgtcttctgggctgatgatggt
ctggacactggggaccttctgcttcagaaggaatgtgaggtgctaccagatgataccgtc
agcactttgtacaaccgcttcctcttccccgaaggcatcaaagggatggtggaggctgtc
aggctcatctcagagggcaaagcccctagactccctcagcctgaagaaggagccacctat
gagggaattcagaagaaggaaacagccaagatcaactgggaccagccagctgaggctatt
cacaattggatccgtgggaatgacaaggtgccaggtgcctggacagaggcttgtggacag
aagctgacatttttcaactcgacgctgaacacatcagaccttgtgccagaaggagaagat
ttgctcatcccaggtgcccatcggccaggcatggtcaccaaagcaggacttatcctcttc
ggaaatgatgacagaatgctactggtgaagaacatacagctagaggatggcaagatgatc
ccagcctcacacttcttcaagggagcagcgagtagtgccctcgagttgacagaggcagag
gtgatcactgcagaggctgtacggagtgcttggcagaggatcctccccagtgttccagac
attgaagattccacggatttcttcaagtcaggagctgcatcagtggatgttgtgaggttg
gtggaagaagtgaaagagctgtgtgatggcctggagttagaaaatgaagatgtttacatg
gcaaccaccttcggggacttcatccagctcttagtgaggaagctgagaggagaggatgaa
gagaatgagtgtgtcattgactatgtggagaaggcagtgaacaagctgactctctacatt
ccgcaccagctcttcatcgggggcatgtttgtggatgctgagggtaccaagacctacgat
gccatcaacccaacagatggaagtgtcatctgccaggtgtccctggcccaggtcagtgat
gttgacaaggcagtggctgcagcaaaggatgcctttgagaatgggctgtgggggaagatc
agcgcacgggaccggggccggctcctatacaggttagcagatctcatggagcagcaccag
gaagaactagccaccattgaggccttggatgccggtgctgtctacacactagccctaaag
actcatgtgggcatgtctatccagaccttccgctactttgctggttggtgtgacaagatc
cagggctgcaccatccccatcaaccaagccagacccaaccgcaacctgaccttgaccaag
aaagagcctgttggtgtctgtggcattgtcattccctggaactatcccctgatgatgctg
tcctggaagacagctgcctgccttgccgctgggaacacagtagtgatcaagcctgcccag
gtaacaccactcacagccttgaagtttgcagagctgacattgaaggctggcattcccaag
ggtgtgatcaacattctcccaggatctggctcactggttggccagagactctcagaccat
cctgatgtgaggaaaattggattcacaggttccacagaggtgggcaaacacatcatgagg
agctgtgccctgagtaatgtgaagaagatttccctggagctgggtgggaagtcacccctc
atcatctttgctgactgtgacctcaacaaggctgtacagatggggatgagctctgtattc
ttcaacaaaggggagaactgcattgcagcagggcggctctttgtagagaactccatccat
gaccagttcgtgcagaaggtggtggaagaggtgaagaagatgaagattggcaatcctctt
gacagagacaccaaccacgggccacagaaccaccaagcccacctaaagaagctgttggag
tattgccagcatggcatgaaagagggggccacactgatctgtggtgggaatcaagtccct
cggccaggtttcttctttgagccaactgttttcacggacgtggaggaccacatgttcata
gccaaggaagagtccttcgggcccatcatgatcatctctcgctttgccgatggggatgtg
gacactgtgctgtctcgcgccaatgccacagaatttggcctggcttctggagtcttcacc
cgggatatcaacaaggccctgtatgtcagtgacaagcttgaagcaggcactgtgtttgtc
aacacatacaacaagactgacgtggctgctccctttggaggattcaagcagtctggattt
ggcaaagatttaggagaggcagccctgaatgaatacctgcgggtcaagacagtgactttc
gagtactga

DBGET integrated database retrieval system