KEGG   Heterocephalus glaber (naked mole rat): 101709693Help
Entry
101709693         CDS       T02812                                 

Definition
lysozyme-like protein 1-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 149 aa AA seqDB search
MKASGVLVLIGCLATVPESHIYIHCKLAKIFLRAGLDNYEGFVLGNWLCMAYYESHYNTM
AQMTLDEXESADYGIFQINSFTWCRDQKFQDKNCCHVACSALLTDDLTDAIICAKKIVRE
TKRMNYWQGWKKHCEGKALSEWKKGCEVS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccagcggggtcctggtcctgattggctgcctggccacagtcccagagtcccac
atctacatccactgtaaactggcaaaaatattcttgagggctggcctggataattatgaa
ggctttgtccttggcaactggctctgcatggcctactatgagagccactacaacaccatg
gcccagatgaccctggacgaatgagagagcgccgactatggcatcttccagataaacagt
ttcacatggtgcagagaccagaagttccaagacaagaactgctgccatgttgcctgctca
gcgctgctcacagatgacctcacagatgcaattatctgtgccaagaaaattgttagggag
acaaaaaggatgaactattggcaaggctggaagaaacattgtgagggcaaagccctgtct
gagtggaaaaaaggatgtgaggtttcatga

DBGET integrated database retrieval system