KEGG   Heterocephalus glaber (naked mole rat): 101709731Help
Entry
101709731         CDS       T02812                                 

Gene name
Gtf3c4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101709731 (Gtf3c4)
Transcription machinery [BR:hgl03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     101709731 (Gtf3c4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 856 aa AA seqDB search
MNTADKARLGPAADGPVPPGEEEGEGGGKEPAADAAPGPSAAFRLMVTRREPAVKLQYAV
SGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGSKT
EVAECKEKFAASKDPTISQTFMLDRVFNPEGKALPAMRGFKYTSWSPMGCDANGRCLLAA
LTMDNRLTVQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPGGNLGDFAEFQRRHS
MQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESISSCN
TIESGISSPSVLFWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWK
EMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSL
PIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSP
CGAYLAIITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLIDLVR
WKILKDKHIPQFLHEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEVLWKPTHEDS
KILLVDSPGTGNAEDEQQEEGTSSRQVSKQERSKDGDTEDPVDDSLPPSGDSGGREPMEE
KLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDDEYDDRTA
RVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRR
CLLHDSIARHPAPEGKSFSRLQPASTWWPGPGSTLLSILPEGGAAPIPLHSAVMEAELIP
VVPGRVMLDRMLSCSV
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgacaaggcccggctggggcccgcggccgacgggcctgtgccgcccggc
gaggaggaaggcgaagggggcgggaaggagccggcggcggacgcagcccccgggcccagc
gccgcgttccgcctcatggtcactcggcgggagccggctgtgaagctgcagtatgcggtg
agcggcctggagccgctggcctggtcggaggaccaccgcgtgtcggtgtccacggcccgc
agcatcgctgttctggagctcatctgcgacgtgcacaacccgggccaggacctggtgatc
caccgcacctcggtccccgccccgctcaacagctgcctcctgaaagttggctcaaaaaca
gaagttgcagagtgcaaggagaaatttgccgcctctaaagaccccaccatcagccagact
ttcatgctggacagggtgtttaacccggaggggaaggccctgcccgcgatgcgagggttc
aagtacactagctggtctcccatgggttgtgatgcgaatggcaggtgcctcttggccgct
ctgaccatggacaatcgcctgactgtccaggcgaacctcaacagactccagtgggtccag
ctggtggatctgactgagatttatggagagcgtttgtatgaaaccagttataggctctct
aaaaatgaggccccaggggggaatcttggggactttgctgagtttcagaggagacacagc
atgcagaccccagtcaggatggagtggtcgggcatctgcaccactcagcaggtcaagcac
aacaatgagtgccgggatgttggcagtgtgctcctggcggtcctttttgaaaatggcaat
attgccgtgtggcagtttcagctgccgtttgtaggaaaggagtccatctcttcatgcaac
acaattgagtcaggaatcagctcgcctagtgttttgttttggtgggagtatgagcacaac
aatcggaagatgagcggccttattgtagggagtgcttttgggcccgtgaagattctccct
gtgaacctcaaggcagtcaaaggctacttcacgctgaggcagcctgttgtcttgtggaaa
gaaatggaccagttgcctgtgcacagcatcaaatgtgtgccactttatcacccttaccag
aagtgcagctgcagcttggtggtagccgccaggggctcctatgtgttctggtgtcttctc
ctcatctccaaggcgggcctgaatgttcacaattcccatgtcacaggccttcactcgctc
cccattgtctccatgactgcagacaaacagaatgggacagtgtacacttgttccagtgac
gggaaggtgaggcagctgattcctattttcacggatgtggcattaaagtttgaacaccag
ctgattaagctctcagatgtgtttggctcagtgaggactcacgggatcgcagtgagcccc
tgcggtgcatatctggccatcatcaccaccgagggaatggtcaacggcctccatcctgtt
aacaaaaactaccaggtccaatttgtcactctcaaaacttttgaggaagcagctgctcag
ctcctggaatcttccgttcaaaatctctttaagcaggtagatttaatagacctagttcgc
tggaagattttaaaagataaacacattcctcagtttttacatgaagctttggaaaagaaa
atcgaaagcagtggggtcacctatttttggcgcttcaagcttttcctcctgaggattttg
taccagtcaatgcaaaaaactccatcggaagtcttgtggaagcccacccatgaggactca
aaaatcctgctagttgactcgcctgggacgggcaatgctgaggatgaacagcaggaagag
ggcacttcctccagacaggtgagcaagcaggaaaggagcaaagacggtgacacagaagac
ccagtggatgactcgctgcccccctcaggagactcggggggccgggagccaatggaggag
aagctcctggagatccaagggaagatcgaggccgtggagatgcacctgacgagggagcac
atgaagcgcgtcctcggggaagtgtacctgcacacctggatcacagagaacaccagcatc
cccacccgagggctctgcaacttcctgatgtctgatgatgagtacgatgacagaacagca
cgggtgctgattggacatatctccaagaagatgaacaagcagactttccctgagcactgc
agtttgtgtaaggagatcttgccattcacagatcgcaagcaagctgtctgctccaacggg
cacatttggctccggtgctttctaacctaccagtcctgccagagcttgatatacagaagg
tgtttgcttcatgacagcattgcccggcacccggctccagaaggtaagagcttttccagg
ctgcagccggcatccacgtggtggccggggccgggctccacactgttgagcatcctgccg
gagggcggagcagctcctatccctcttcacagtgctgtcatggaggcagagctaattcca
gtggtccctgggcgcgtcatgttggaccgcatgctgtcttgcagtgtgtga

DBGET integrated database retrieval system