KEGG   Heterocephalus glaber (naked mole rat): 101710293Help
Entry
101710293         CDS       T02812                                 

Definition
chymotrypsinogen B-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101710293
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101710293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 263 aa AA seqDB search
MVSLWLLSCFALVAAVHGCGVPAVQPVLSGLARIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISPDWVVTAAHCGVTTSDVVVAGEFDQGSDEEDVQVLKIAKVFKNPKFNIFTVRND
ITLLKLATPAQFSKTVSAVCLPSASDDFSAGALCVTTGWGKTKYNANKTPDKLQQAVLPL
VSTANCKKYWGTKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCDT
SAPAVYARVTALLPWVQEILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggtctccctttggcttctgtcctgctttgccttggtagcagccgtccatggctgtgga
gtccctgccgtccaacctgtgctgagtggcctggccaggatcgtcaatggcgaggatgct
gtccccggctcctggccctggcaggtgtccctacaggacaaaactggcttccacttctgc
gggggctccctcatcagcccggactgggtggtcaccgctgcccactgcggggtcacaaca
tccgatgtggtggtggctggggagtttgaccaaggctctgatgaggaggatgtccaggtc
ttgaagatcgcaaaggttttcaagaaccccaagttcaacatattcaccgtgcgcaatgac
atcaccctgctgaagctggccacacctgcccagttctccaaaaccgtgtctgccgtgtgc
cttcccagtgccagtgatgacttctctgctggggccctgtgtgtcaccactggctggggc
aagaccaagtacaatgctaacaagacccccgacaagctacagcaggcagtcttgcccctg
gtgtccactgccaactgcaagaagtactggggcaccaagattactgacgtgatgatctgc
gccggggccagcggcgtctcctcctgcatgggtgactctggtgggcccctggtgtgccag
aaggacggagcctggaccctggtaggcatcgtgtcctggggtagcggcacctgcgacacc
tccgctcccgctgtgtatgctcgtgtcactgcactcctgccctgggttcaggagatcctg
gaagccaactga

DBGET integrated database retrieval system