KEGG   Heterocephalus glaber (naked mole rat): 101711015Help
Entry
101711015         CDS       T02812                                 

Gene name
Kat2b
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101711015 (Kat2b)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101711015 (Kat2b)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101711015 (Kat2b)
  Infectious diseases
   05166 HTLV-I infection
    101711015 (Kat2b)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101711015 (Kat2b)
Transcription machinery [BR:hgl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101711015 (Kat2b)
Chromosome [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101711015 (Kat2b)
   HAT complexes
    PCAF complex
     101711015 (Kat2b)
    STAGA complex
     101711015 (Kat2b)
    TFTC complex
     101711015 (Kat2b)
    SAGA complex
     101711015 (Kat2b)
    SLIK complex
     101711015 (Kat2b)
    ADA-HAT complex
     101711015 (Kat2b)
    HAT-A2 complex
     101711015 (Kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 742 aa AA seqDB search
TAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPR
ADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDAD
TKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQ
TIVELAKMFLNRINYWHLEAPSQRRLRSPNEDISGYKENYTRWLCYCNVPQFCDSLPRYE
TTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNS
PIWDQDFLSVSSRTSQLGIQTVISPPPVAGAVSYNSNSSSLEQPNGGSTSPACKASCGLE
ANPGEKRKMNDSHVLEEAKRPRVMGDIPMELISEVMSTITDPASMLGPETNFLSAHSARD
EAARLEERRGVTEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPK
HKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDI
LNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVI
IKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPVESIPGIRETGWKPSGKDKSKEP
KDPDQLYSTLKSILQQVKNHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYY
VSKKLFMADLQRVFTNCKEYNP
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
acggccgagggcccgggaggcggcggctcggcccggatcgccgtgaagaaggcgcagctg
cgctccgcgccgcgggccaagaaactggagaaactcggagtgtactccgcctgcaaggct
gaggagtcctgtaaatgtaatggctggaaaaaccccaacccttctcccacgccccccaga
gccgatctgcagcagatcattgtcagcctgactgagtcctgtcggagttgtagccatgcc
ctcgctgctcatgtttcccacctggagaatgtgtcagaggaagagatgaacaggctcctg
ggaatagtgttggatgtggaatatctctttacctgtgtccacaaggaagaagatgcagat
accaaacaagtttatttctatctatttaagctcttgagaaaatctattttacaaagagga
aaacctgtggttgaaggctctttggagaagaagcctccatttgaaaagcctagtattgaa
cagggtgtgaataactttgtacagtacaaatttagtcacctgccatcaaaagaaaggcaa
acaatagttgagttggcaaaaatgttcctaaaccgtatcaactattggcatctagaggca
ccatctcaacgaagactgcgatctcccaatgaggatatttctggatacaaagagaactac
acaaggtggctgtgttactgcaatgtgccccagttctgtgacagtctacctcggtatgaa
accacccaggtgtttgggagaacgttgcttcgctcggtcttcactgtaatgaggcgacaa
ctcctggaacaagcaagacaggaaaaagacaaactgcctcttgagaaacgaactctaatc
ctcacccatttcccaaagtttctgtccatgttagaagaagaagtttatagtcaaaactcc
cccatctgggatcaggattttctctcagtctcttccagaaccagccaactaggaatccaa
acagttatcagtccgcctcctgtggctggggcagtttcatacaattcaaattcatcttcc
cttgagcagccgaatggaggcagcaccagtcctgcctgcaaagcctcttgtgggcttgag
gcaaacccaggagaaaagaggaaaatgaatgattctcatgttctggaggaggccaagaga
ccccgagttatgggggatattcctatggaattgatcagtgaggtcatgtcaactatcaca
gaccctgcctcgatgcttggaccagagacaaattttctgtcagcacattcagccagggat
gaggcggcgaggctggaggagcgcaggggtgtgactgagtttcatgtggttggcaattcc
ctgaaccagaaaccaaacaagaagatcttgatgtggctcgtcggccttcagaacgtgttc
tcccatcagctgccccgaatgcccaaagagtacatcacacggcttgtctttgacccgaaa
cacaaaactcttgctttaattaaagatggccgtgtcattggtggtatctgtttccgaatg
ttcccatcccaaggattcacagagattgttttctgtgctgtcacctcaaatgagcaagtc
aagggctacggaactcacctgatgaatcatttgaaagaatatcatataaaacatgacatc
ctgaacttcctcacatatgcagatgaatatgcaattggatacttcaagaaacagggtttc
tccaaagaaattaaaatacctaaaaccaaatatgttggctacatcaaggattatgaagga
gccactttaatgggatgtgagctaaacccacggattccatacacagaattttctgtcatc
attaaaaagcagaaggagataattaaaaagctgatagaaagaaaacaggcccagattcga
aaagtctatcctggactttcatgttttaaagatggagttcgacagattcctgtagaaagc
attcctggaattagagagacaggctggaaaccgagtggaaaagacaaaagtaaagagccc
aaagaccctgaccagctttacagcacattgaagagcatcctccagcaggtgaagaaccat
caaagcgcttggcccttcatggaacctgtgaagagaacagaagctccgggatattatgaa
gttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaataggtactac
gtgtctaagaaattattcatggctgatttacagcgagtctttaccaattgcaaagagtac
aacccc

DBGET integrated database retrieval system