KEGG   Heterocephalus glaber (naked mole rat): 101712354Help
Entry
101712354         CDS       T02812                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     101712354
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101712354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
MVEMVPSAVLLILAVSATAKDDGTCDGPCGLRFRQNPHGGVRLIGGQTAQLGAWPWMVSL
QIFRAHTNRRYHVCGGVLLNSHWVLTAAHCFDSKKKVYDWRLVFGAQEIEYGNNEPVRAP
VQERYVEKIIIHEKYSSVNQGNDIALLKITPALSCGQFIGPGCLPTFKAGPPQIPQTCYV
AGWGYIKENAPRPSPVLLEARVKLIDLDLCNSTQWYNGRVMSTNVCAGYPEGKIDTCQGD
SGGPLMCRDNANSPFVVVGITSWGVGCARAKRPGIYTATWDYLEWIASKTGPSVLHAIQP
ATPPPPPSRPRPPARPTSSRPPAANPPWYFQSPARPPPPPPPPPPPPRPLQPFAPQPQPP
TAQGPPRPSPSPPPSPPSPPPPPSPTRPTQGLSFAQRLQQLIEALKXMRRSGPKSSYGME
IPELPEPISF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtggagatggtgccaagcgccgttctgctgatattggctgtgtctgcgaccgccaaa
gatgacggcacttgtgatggcccctgtgggttgcggttcaggcagaacccacatgggggt
gtccgactcatcggagggcagacagcacagctcggggcctggccctggatggtgagcctc
cagatcttcagggcccacaccaaccgcaggtaccatgtgtgtggtggcgtcctgctgaat
tcgcactgggtgctgacagcggctcactgcttcgacagcaaaaaaaaagtctatgactgg
agactggtttttggagcacaggaaattgaatatggaaacaatgagccagtgagggcacct
gtgcaggagagatatgtggagaaaatcatcatccatgaaaaatacagcagtgtgaatcaa
gggaatgacattgctctcttgaagatcacccctgctctttcatgtggacagttcattggg
ccaggctgcctgcccacttttaaggcaggccctccccaaattccccagacctgctatgtg
gctggctgggggtacataaaggagaatgcccctaggccatcgcctgtgctgctggaggcc
cgtgtgaagcttattgaccttgacctgtgtaactcgacccagtggtacaatgggagggtc
atgtcaaccaatgtgtgcgccggctatccagaaggcaagatcgacacctgccagggggac
agcggcgggcctctcatgtgcagagacaacgcgaacagccccttcgtggtcgtggggatc
acgagttggggggtaggctgtgcccgtgccaagcgccctggaatctacacagcgacttgg
gactatctggagtggattgcttccaagactggtcctagtgtcctgcatgcgattcagcca
gctacccctccccctcccccctctcggccaaggcccccagcccggcccacctcttcccgc
ccccccgctgcaaaccctccttggtatttccaaagccctgctcgccctcctcctcctcct
cctcctcctcctcctcctcctcgaccccttcaacctttcgcacctcagccccaaccgcct
acagcccagggcccaccccgaccctccccctctcctcccccctcgcctccttctccccct
cctccgccatcgcccaccagaccgacccaaggactctcttttgcccagcgcctccagcag
ctcattgaggctctgaagnggatgcgccgttctggcccaaagagctcttacggcatggag
ataccagagctcccagaacccatctctttctga

DBGET integrated database retrieval system