KEGG   Heterocephalus glaber (naked mole rat): 101712555Help
Entry
101712555         CDS       T02812                                 

Gene name
Por
Definition
(RefSeq) P450 (cytochrome) oxidoreductase
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101712555 (Por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 678 aa AA seqDB search
MGDSHMDTGATNAEAVAEEVSLFSTTDMIVFSVIIGVLTYWFLFRKKKEEMPEFTKISTT
TTSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA
DLSSLAEIDNSLVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGIKYAVFGLGNKTYEH
FNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEATGEES
SIRQYELVVHMDIDEARVYTGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERYL
MHLELDISDSKIRYESGDHVAIYPANDSNLVNQLGKILGADLDVVMSLKNLDEESNKKHP
FPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEQLRKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYET
KSGRINKGVATSWLQAKNPAGDNGRRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGVAPF
MGFIQERAWLQQQGKEVGETLLYYGCRRSDEDYLYREELAQFHKEGALSGLNVAFSREQA
HKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFCDIAAELGAMEHAQAV
EYIKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggggactcccacatggacaccggtgccaccaatgctgaggcagttgccgaagaagtg
tctctcttcagcacaacagacatgattgtcttttctgtcatcattggggtcctaacctac
tggttcctctttagaaagaaaaaagaagaaatgcccgagttcaccaaaatttcgacaacg
accacctctgtcagagagagtagcttcgtggaaaagatgaagaagacggggaggaacatc
atcgtgttctatggctcccagacggggaccgctgaggagttcgctaaccgcctatccaag
gatgcccaccgctatggcatgcggggcatggcggcagatcccgaggagtatgacctggcc
gacctgagcagcctggcagagatagacaactcgctggtggttttctgcatggccacctac
ggcgagggggaccccactgacaacgcccaggacttctacgactggctgcaggagacggat
gtggacctctccggtatcaagtatgcggtgttcggcctagggaacaagacctatgagcac
ttcaatgccatgggcaagtacgtggaccagcggctagagcagcttggagcacagcgcatc
ttcgagctgggcctgggcgatgatgatgggaacttggaggaggacttcatcacatggcga
gagcagttctggccggccgtgtgtgaattctttggggtggaggccactggagaggagtcc
agcattcgccagtacgagctcgtggtccacatggacatcgacgaggccagggtgtacacg
ggcgagatgggccgtctgaagagctatgagaaccagaaacccccctttgatgccaagaat
ccattcttggctgccgtcaccaccaaccggaagctgaaccagggaactgagcgatacctc
atgcacctagaattagacatctcagactccaaaatcaggtatgagtctggggaccatgtg
gccatttacccggccaacgactccaaccttgtcaaccaacttgggaagatcctgggtgcc
gacctggatgttgttatgtccctgaaaaacctagacgaggagtccaacaagaagcacccg
ttcccctgccccaccacctaccgtacggctctcacctactacctggacatcaccaacccg
ccacgcaccaacgtgctctacgagctggcgcagtacgcctcagagccctccgagcaggag
cagctgcgcaagatggcctcgtcctcgggtgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctggccatcctgcaggactacccgtccttgcggccaccc
atcgaccacctgtgtgagctgctgccgcggctgcaggcccgctactactccatcgcctcc
tcctccaaggtccaccccaactccgtgcacatctgtgccgtggtcgtggagtatgagacc
aagtcaggccgcatcaacaaaggcgtggccaccagctggctgcaggccaagaatccggcc
ggggacaatggccgccgggccctggtgcccatgttcgtgcgcaagtcccagttccgcctg
cccttcaagtccaccacaccagtcattatggtgggccctggcactggggtggcccccttc
atggggttcatccaggagcgggcctggctgcagcagcagggcaaggaggtaggggagaca
ctgctgtactatggctgccgccgctcggacgaagactacctgtaccgcgaggagctggcc
cagttccacaaggagggcgccctctccgggctcaacgtggccttctcccgggagcaggcc
cacaaggtctatgtgcagcacttgctgaagagggacaaggagcacctgtggaagctgatc
cacgagggcggtgcccacatctatgtctgcggggacgcgcgcaacatggccagggacgtg
cagaacaccttctgcgacatcgcggctgagcttggcgccatggagcacgcccaggcggtg
gagtacatcaagaagctgatgaccaagggccgctactccttggatgtgtggagctag

DBGET integrated database retrieval system