KEGG   Heterocephalus glaber (naked mole rat): 101712656Help
Entry
101712656         CDS       T02812                                 

Gene name
Ckb
Definition
creatine kinase, brain
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hgl00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MPFSSSHNAVKLNFPAEDEYPDLSCHNNHMAKVLTPELYGELRAKSTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYDVFKALFDPIIEDRHGGYQPGDEHKTDLDPDNLQGGDD
LDPSYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFPEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctccagcagccacaacgcggtgaagctgaacttccccgccgaggacgagtac
cccgacctgagctgccacaacaaccacatggccaaggtgctgacccccgagctgtacggc
gagctgcgcgccaagagcacgccgagcggcttcacgctggacgacgtcatccagaccggc
gtggacaacccgggccacccgttcatcatgaccgtgggctgcgtggcgggcgacgaggag
tcctacgacgtgttcaaggcgctcttcgaccccatcatcgaggaccgacacggcggctac
cagccgggcgacgagcacaagaccgacctcgacccggacaacctgcagggcggcgacgac
ctggaccccagctacgtgctcagctcgcgggtgcgcaccggccgcagcatccgcggcttc
tgcctgcccccgcactgcagccgcggggagcgccgggccatcgagaagctggcggtggaa
gccctgtccagcctggacggcgacctggccggcaggtactacgcgctcaagagcatgacc
gaggcggagcagcagcagctcatcgacgaccacttcctcttcgacaagcccgtgtcgccg
ctgctgctggcctccggcatggcccgtgactggcccgacgcccgcggcatctggcacaat
gacaataagaccttcctggtgtgggtcaacgaggaggaccacctgcgggtcatctccatg
cagaaagggggcaacatgaaggaggtgttcacccggttctgcacaggcctcacccagatc
gaaactctcttcaagtctaagaactacgagttcatgtggaacccgcacctaggctacatc
cttacctgcccgtccaacctgggcactgggctgcgggcaggcgtgcacatcaagctgccc
cacctgggcaagcatgagaagttccctgaggtgctcaagcggcttcggctgcagaagcga
ggcacaggcggtgtggacacagctgccgtaggcggggtcttcgatgtctccaacgctgac
cgcctgggcttctcggaggtggagctggtacagatggtggtggatggggtgaaactgctc
atcgagatggagcagcggctggagcagggccaagccatcgacgacctcatgcccgcccag
aagtga

DBGET integrated database retrieval system