KEGG   Heterocephalus glaber (naked mole rat): 101713242Help
Entry
101713242         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B18
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101713242
   00053 Ascorbate and aldarate metabolism
    101713242
   00500 Starch and sucrose metabolism
    101713242
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101713242
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101713242
   00860 Porphyrin and chlorophyll metabolism
    101713242
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101713242
   00982 Drug metabolism - cytochrome P450
    101713242
   00983 Drug metabolism - other enzymes
    101713242
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101713242
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101713242
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101713242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 238 aa AA seqDB search
MEDFVQSSGEHGVVVFTLGSMVRNITEERANVIASALAQIPQKVIWRFDGKKPDTLGYNT
KLYKWIPQNDLLGHTKTKAFITHGGTNGIYEAIYHGVPMVGIPLFGDQPDNIVRMKAKGA
AVRLDFITMSSTDLLNALKTIINDPYYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHK
GAKHLRVAAHNLSWFQYHSLDVIGFLLTCVVSLVFIIIKCCLFCCRKFTKTGKKKKRE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaagactttgtgcagagctctggagaacatggtgttgtggtgtttactctggggtca
atggtcaggaacataacagaagaaagagccaatgtaattgcgtcagcccttgctcagatt
ccacaaaaggtaatatggagatttgatggcaagaaaccagataccctaggatacaacact
aagctgtacaaatggatccctcagaatgaccttcttggtcacaccaaaaccaaagctttt
ataactcatggtggaaccaatggcatatatgaggcaatctaccatggtgtccctatggtg
ggcattcctttgtttggggatcaaccggataacattgttcgcatgaaggccaagggagca
gctgttagattggatttcatcacaatgtcaagtacagatttgctcaatgcattgaagacc
atcattaatgatccttactataaagagaatgccatgaggttatcaagaattcaccatgac
cagccagtgaagcccctggaccgagcagtcttctggattgagtttgtcatgcgccacaaa
ggggccaagcaccttcgagttgcagcccacaacctgtcctggttccagtaccactcttta
gatgtgattgggttcctgctgacctgtgtggtcagtctggtattcatcatcattaaatgt
tgtctattttgttgcagaaagtttacaaaaactggaaaaaagaaaaaaagggagtaa

DBGET integrated database retrieval system