KEGG   Heterocephalus glaber (naked mole rat): 101713242Help
Entry
101713242         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B18
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101713242
   00053 Ascorbate and aldarate metabolism
    101713242
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101713242
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101713242
   00860 Porphyrin and chlorophyll metabolism
    101713242
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101713242
   00982 Drug metabolism - cytochrome P450
    101713242
   00983 Drug metabolism - other enzymes
    101713242
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101713242
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101713242
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101713242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Shisa
Motif
Other DBs
NCBI-GeneID: 101713242
NCBI-ProteinID: XP_012923591
Position
Un
AA seq 238 aa AA seqDB search
MEDFVQSSGEHGVVVFTLGSMVRNITEERANVIASALAQIPQKVIWRFDGKKPDTLGYNT
KLYKWIPQNDLLGHTKTKAFITHGGTNGIYEAIYHGVPMVGIPLFGDQPDNIVRMKAKGA
AVRLDFITMSSTDLLNALKTIINDPYYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHK
GAKHLRVAAHNLSWFQYHSLDVIGFLLTCVVSLVFIIIKCCLFCCRKFTKTGKKKKRE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaagactttgtgcagagctctggagaacatggtgttgtggtgtttactctggggtca
atggtcaggaacataacagaagaaagagccaatgtaattgcgtcagcccttgctcagatt
ccacaaaaggtaatatggagatttgatggcaagaaaccagataccctaggatacaacact
aagctgtacaaatggatccctcagaatgaccttcttggtcacaccaaaaccaaagctttt
ataactcatggtggaaccaatggcatatatgaggcaatctaccatggtgtccctatggtg
ggcattcctttgtttggggatcaaccggataacattgttcgcatgaaggccaagggagca
gctgttagattggatttcatcacaatgtcaagtacagatttgctcaatgcattgaagacc
atcattaatgatccttactataaagagaatgccatgaggttatcaagaattcaccatgac
cagccagtgaagcccctggaccgagcagtcttctggattgagtttgtcatgcgccacaaa
ggggccaagcaccttcgagttgcagcccacaacctgtcctggttccagtaccactcttta
gatgtgattgggttcctgctgacctgtgtggtcagtctggtattcatcatcattaaatgt
tgtctattttgttgcagaaagtttacaaaaactggaaaaaagaaaaaaagggagtaa

DBGET integrated database retrieval system