KEGG   Heterocephalus glaber (naked mole rat): 101713625Help
Entry
101713625         CDS       T02812                                 

Gene name
Kat6a
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101713625 (Kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2036 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAFEGLAEPGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAISHGRLLKEGPLYRLNTKAANAEGKE
SSESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTIRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLIRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKSPFSKVQTGP
GRGRKRKITLSSQSASSSEEGYLERIDGLDFCRDSNVPLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSIIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQLSIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEDEEEEADEEENEEPQCQERDLETNVGKSVSRENKDQDSYSSVESEKKPEVTAP
AVSTRLSKQVLPRNSLPANSQPSRRGRCGRKNRKTQERFGDKESKLLLEETSSAPQEQYG
ECEEKSETSQEQYAESEEQLTASQEQPRQEGKPDIPKRRLSEGIELWRGQLKKSPEDLKC
RLPEGNDRLQRCYSDGDRAVLRGFSESSEEEEEEEEEEEEEEEEPESSRSNSPPILTKPT
LKRKKPVLHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIEE
EEEEEEEEEEEEEEENELFHRGYFHRLSSQSVLRCRSASKRKSKEEEEDEESDDPDDTPI
LKPVSLLRKCDVHNSSLEPDTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGLKLNREIMA
ISTQECIIEPIVPIPKPGRKTKTQENEKTVELKEDIPLLEERKEEEMQVEAEEVEEGEEE
DTTISEVRPASPVDSSDSPETEAKVPEVEEEEEKPHMLEEQRQSEEEPQELEEQEPEEED
EVTIEANRNEDHDADDEDDGHLESSKKKESEEQLVRGDLKEEPGSQESFLDTNMQNNREN
IKDKDETEPDSEEEQPSHEASVVSEHMPGSEDDHEEDSNTKEELIELKEEEEISHSELDL
ETVQAVQSLTQEESNEHEGAYQDCEETLAACQTLQSYTQADEDPQMSMVDDCHASEHNSP
ISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHS
QQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNS
CVVTQQMANMGSSCSMMQQNTVQPATNCNIKSPQSCVVERPPSNQQPPPPPPPQQQQQQQ
QQQQQQQQPAPQPPPPQPQPQPQPQPQQQPQQQPQPQQPQQPQPPPPPQQQPPLSQCSMN
NSFTPAPMIMEIPESGSTGNISIYERIPGDFGASSYSQPSATFSLAKLQQLTNTIMDPHA
MPYSHSSAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLL
QCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPTVAMQAGP
RALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNSPYMNQTAQ
YPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6111 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatactgagtggattttggaggccatcaaaaaagtg
aagaagcagaaacagcgtccttcagaagaaaggatatgcaatgcagtgtcttcatctcat
ggcttggatcgtaaaactgttttggaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaacaaaggtctcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataagcaaaatgtagattggaat
aaactgatcaaaagggcatttgagggcttggcagagcctggtgggtcaactttgaaaagt
attgaacgctttttgaaaggtcagaaggatgtatcggcattatttggaggcagcgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccatcagtcatggcagactc
cttaaagagggacctctctatcggctcaacactaaagcagccaatgctgaggggaaggag
agttctgagtctctttcctgtttacctccagtttcactgcttccacatgaaaaggacaag
ccggttgctgaaccaatccccatctgtagtttttgtcttggtacaaaagaacaaaaccgg
gaaaagaagccggaggaactcatctcttgtgcagactgtggcaatagtggtcatccatcc
tgtttaaaattttcccctgaactaacaattagagtgaaggccttacggtggcagtgtatt
gagtgtaaaacttgcagctcctgtcgagatcaaggcaaaaatgcagataacatgcttttt
tgtgactcatgtgaccgaggttttcacatggaatgttgtgatccgccactcattcggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctagaaaaaaaggacgaaaactgcta
caaaagaaggcagcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaagtcccttcagcaaagttcaaactggccct
ggaaggggtaggaaacgtaaaatcactctctccagccaatcagcatcatcatcagaagaa
ggatatttagagcgaatagatggcttggatttctgcagagatagtaatgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttcccct
gatgggcggaaagctcgaggggaagtggtagactactctgagcaatatagaatcaggaaa
aagggcaacagaaaatcaagcacttcagattggcccacagacaatcaagatggctgggat
ggcaaacaagaaagtgaggagcggctttttgggagccaggaaatcatgactgagaaagat
atggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggtccc
cctgatccacaagttcgttgtccttctatcattgagtttggaaagtatgaaattcacacc
tggtactcctctccatatcctcaagaatattcaaggctgcctaaattgtatctttgtgag
ttttgtctaaaatatatgaaaagtagaactattctacagcaacacatgaagaaatgtggt
tggttccatcctcctgccaatgagatttaccgaaagaataatatttctgtctttgaggtt
gatgggaacgtgagtaccatttattgtcaaaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggaaccatttcttttttatgtactaacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccagcagaaa
tacaacgtttcctgtataatgattcttccccagtaccagcgcaagggctatggcaggttc
ctcattgatttcagttatttgttatcaaagcgtgaaggccaggcagggtctccagagaaa
ccattatcagatcttggacgtctttcctatatggcttattggaaaagtgtaatattggag
tgcctttatcaccaaaatgacaaacaactcagcatcaagaagttaagtaagttgactgga
atctgccctcaagacatcacttccacactgcaccacctacgaatgctggacttccgtagt
gaccaatttgtgattatccgccgggaaaaacttatccaggatcatatggcaaagcttcag
ttgaatctgagaccagtggatgtagatccagaatgtttacgctggactcctgtcatagtc
tccaactctgttgtctcagaggacgaagaagaggaagctgatgaagaagaaaacgaagag
ccgcagtgccaggaaagagatttagagaccaatgtgggaaagtcagtatctcgggaaaac
aaagatcaagattcttattcttcagtagaaagtgaaaagaaaccggaagttacagctccc
gctgtctctacacgtttgagcaaacaggtccttccccgaaacagtcttcctgcaaacagc
cagccctctcggcggggccgctgcgggaggaagaacagaaagacccaggaacggtttggt
gataaagagtctaaactgctcttggaagagacttcatcagctcctcaggaacaatatgga
gaatgtgaggaaaagtcagaaacctcccaagaacaatatgccgagagtgaggagcaattg
acagcctctcaggagcagccaaggcaggaagggaagccagacattcccaaaagaagatta
agtgaggggattgagctgtggcggggacagttaaagaaaagccccgaggacctgaagtgc
agattaccagaaggaaatgatagactgcagcgctgctacagtgatggtgacagggctgtc
cttagaggctttagtgagagtagtgaggaggaagaggaggaggaggaggaggaggaggag
gaggaggaggaaccagaaagttctcggtcaaactcaccaccaattcttacaaaacccact
ttaaagagaaagaaaccagttcttcaccgaagaaggagagtccgaaaacggaaacaccat
aatagcagtgtagtcacagaaactatttctgagaccacagaggtgttagatgaacctttt
gaagattctgattctgagagaccaatgccgcgattagaacccacatttgagattgaggaa
gaggaggaggaggaggaggaggaggaggaggaagaggaggaggagaatgagctcttccac
agaggatacttccaccgcctgtcctcacaaagtgttctcaggtgccgatctgcttcaaag
aggaagtcaaaagaggaagaggaagatgaagaatcagatgatcctgatgacactcctatc
ctaaagccagtatctctcttacgaaaatgtgatgtgcacaattcttcccttgagccagat
acatcgacacctatgaaaaagaaaaagggatggcccaaaggcaagagccgtaaaccaatc
cactggaagaaaagacctggtcgaaaaccgggacttaagttgaatcgggaaatcatggcc
atttctactcaagaatgcatcattgagccgattgtccccattcctaaacctggacgtaaa
accaaaactcaagagaatgaaaaaactgtggagctaaaagaagacatccccttattggaa
gaaagaaaggaagaggagatgcaagtagaagcagaagaggttgaagaaggagaggaagag
gacacaaccatcagtgaagttagacctgcttctccagtggacagcagcgacagtcctgag
acagaagcaaaagtacctgaggtggaggaggaagaagagaaacctcatatgttagaagag
caaaggcagtcagaggaggagccacaagaactagaagaacaagagccagaggaagaagat
gaagtgactatagaggcaaaccggaatgaagaccatgatgcagatgatgaggatgatggt
catctggaatcttcaaagaaaaaggagtcagaggagcagctggttagaggggatctcaag
gaagaacctggcagtcaggaatcttttttagatactaacatgcagaataatagggagaat
ataaaggataaagatgaaacagaaccagattctgaagaggaacagccttctcatgaggca
tctgtggtatcagagcatatgccagggtctgaggatgaccatgaagaagattcaaatact
aaggaagaattaattgagttgaaagaggaagaagagatatctcatagtgaattggacctt
gaaactgtacaagcagtacagtctttgactcaagaagaaagcaatgaacatgagggagcc
taccaggactgtgaagaaactcttgcagcttgtcagaccctgcagagttacacccaggcc
gatgaagaccctcagatgtcaatggttgacgactgccatgcttccgaacataatagccca
atatcctcagttcagtctcatcccagccagtctgtccgttcggtcagcagccccaatgtg
cctgccttggagagtggttacacgcagatcagcccagaacagggctccctgtccgcaccc
tctatgcagaacatggagaccagccccatgatggatgtgccttctgtatcagaccactct
cagcaggtggtagacagtggcttcagtgatctaggcagtattgagagtaccacagagaac
tatgagaatcctagcagctatgattctacaatgggaggcagcatttgtgggaataactcc
tctcaaagcagctgctcctatggtgggttgtcatcctccagcagcctcacccagaacagc
tgtgttgtcactcagcaaatggcaaatatgggcagcagctgcagtatgatgcagcagaac
actgtccagcctgctaccaactgcaatatcaagtcacctcaaagttgtgtggtggaaagg
cctcctagtaaccagcagccaccaccaccgccaccaccacagcagcaacagcagcagcag
caacaacagcagcagcagcagcaaccagcaccacagcctccaccaccccagccacaacca
caaccacaaccacagccacaacagcagccgcagcagcaacctcagccccagcagccccag
caacctcagcccccaccccctccccagcagcagcccccactgtcacagtgtagtatgaat
aacagtttcactccagctcctatgatcatggagataccagaatctggaagcactggaaac
atcagtatctatgaaagaattccaggagattttggtgccagcagctactctcaaccatca
gccaccttcagtttagccaagttgcagcagctgactaacaccattatggacccccatgcc
atgccttatagccattcttctgctgtaacttcctatgcaaccagtgtttctttgtccaat
acaggactggctcagctagctccgtctcatccattagctgggacccctcaagcacaagcc
accatgacaccacctcccaacttggcatccacaaccatgaacctcacatcacctctactc
cagtgcaacatgtctgccaccaacattggcattcctcacactcagaggttgcaagggcaa
atgccagtcaaggggcacatttccatccgctctaaatctgcaccactgccctcagcagca
gctcaccagcagcagctgtatggccgcagcccacccacagttgccatgcaggctggccct
cgtgcactggctgttcagcgtggcatgaacatgggggttaatttaatgccaactcctgcc
tataatgtcaactccatgaatatgaacaccttgaatgccatgaacagctatcgaatgaca
cagcccatgatgaacagcagttaccatagtaactctccctacatgaaccagacagcacag
tatcctatgcagatgcagatggggatgatggggagccaggcctatacccagcagcctatg
cagccaaaccctcatggaaacatgatgtacactggcccctcccatcacagctacatgaat
gctgctggtgtgcccaagcagtcactcaatggaccttacatgagaagatga

DBGET integrated database retrieval system