KEGG   Heterocephalus glaber (naked mole rat): 101713955Help
Entry
101713955         CDS       T02812                                 

Gene name
Ugt2a1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101713955 (Ugt2a1)
   00053 Ascorbate and aldarate metabolism
    101713955 (Ugt2a1)
   00500 Starch and sucrose metabolism
    101713955 (Ugt2a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101713955 (Ugt2a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101713955 (Ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    101713955 (Ugt2a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101713955 (Ugt2a1)
   00982 Drug metabolism - cytochrome P450
    101713955 (Ugt2a1)
   00983 Drug metabolism - other enzymes
    101713955 (Ugt2a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101713955 (Ugt2a1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101713955 (Ugt2a1)
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101713955 (Ugt2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MLSNILLLSLQISLLGTTLGGNILIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPSSYPSLTFEIYKVSFGKERVERVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSREICDGVLKNEMLMEKLKKGKFEVLVSDPVFPCGDIVALKLGIPFIYSLRFSPASNVE
KHCGKVPYPPSYVPAILSELTDQMTFADRVRNFISYHLQDYMFETLWKPWDSYYSKALGK
PTTLCETMSKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGED
GIVVFSLGSMVKNLTEEKANLIASALSQIPQKVLWRYKGKKPAMLGPNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTS
ADLLNALRIVINDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LSWFQYHSLDVIGFLLGCVASVVFLVTKCCLFSYQKFIRKGKRIKKE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcaacattctgctgttgtctcttcagataagcctcctaggaaccactcttggt
gggaacatcctgatttggccaatggaaggtagtcactggctcaatgttaagatcattata
gatgagctcattaaaaaagagcataatgtgactgtcctggttgcctctggtgcacttttc
atcacaccatcttcttacccgtctctgacatttgaaatatataaagtgtcctttggaaaa
gaaagagtagaaagagtgatcaaggattttgttttgacatggctggaaaataggccatct
ccttcaaccatctggagattctatcaggagatggctaaagtcataaaggacttccacatg
gtgtctagagagatctgtgatggtgttcttaaaaatgaaatgctgatggaaaagctgaag
aaaggcaagtttgaagtcctggtatcagatccagtattcccttgtggtgatatagtagct
ttaaagctgggaataccattcatctattccttgaggttttctccagcctcaaatgtggaa
aagcactgtgggaaagtaccataccctccttcctatgttcctgctattttatcagaactt
actgaccagatgacatttgcggacagagtaagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaaccatgggattcctactatagtaaagcattgggaaaa
cccactacgttatgtgagactatgagcaaagctgaaatttggctaattcggacatattgg
gattttgaatttcctcgtccattcttgcctaattttgagtttgttggaggactgcactgc
aaacctgccaaacctttacctaaagaaatggaagaatttgtccagagttctggtgaagat
ggtattgtggtgttttctctggggtcaatggtgaaaaacctcacagaagaaaaggccaat
ctcatcgcctcggccctctctcagattccacagaaggttttgtggagatacaagggaaag
aagccagccatgttaggaccgaatactcagctgtttgattggattccccagaatgacctt
ctcggtcatcccaaaactaaagctttcatcactcatggtggaactaatgggatctatgaa
gctatttatcatgggatccctatggtgggggttcccatgtttgcagatcaacctgacaac
attgctcacatgaaggccaaaggagcagctgtggaggtcaacatgaacacaatgacgagt
gcagacctgctcaatgccttgagaatagtcatcaatgacccttcttataaagagaatgcc
atgaggttatcaagaattcaccatgaccagccagtgaagcccctggaccgagcagtcttc
tggattgagtttgtcatgcgccacaaaggggccaagcaccttcgggttgcagcccacgac
ctgtcctggttccaatatcactctttggatgtgattgggttcctgttgggctgtgtagca
agtgttgtattcttggtcacaaagtgttgtttgttttcctatcaaaaatttattaggaaa
ggaaagaggataaagaaggaatag

DBGET integrated database retrieval system