KEGG   Heterocephalus glaber (naked mole rat): 101715076Help
Entry
101715076         CDS       T02812                                 

Definition
acyl-CoA desaturase 1-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hgl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hgl01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hgl03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 356 aa AA seqDB search
MPAHMLQEMSGSYTTTTTITAPPGGLQNGVQKPDPAPQYAEADVRPEIDDTHDPSYQDEE
GPPPKLEYVWRNIILMTLLHTGALYGITLVPTCKFYTVLWAYLYYVVSALGITAGAHRLW
SHRTYKARLPLRIFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVG
WLLVRKHPAVKEKGGLLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFL
HSLYVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNIESRENILVSLGAVGEGFHNYHHA
FPYDYSASEYRWHINLTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSYKSG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacatgctgcaggagatgtctggctcctacaccaccaccactaccatcaca
gcgccccctgggggcctgcagaatggagtacagaagccggacccggctccccagtacgcg
gaagcagacgtccgccctgaaatagatgacacgcacgaccccagctaccaggacgaggag
ggccccccgcccaagctggagtacgtctggagaaacatcatcctgatgaccctgctgcac
acgggagccctgtacgggatcacactggttcccacctgcaagttctacactgtcctgtgg
gcatatctgtactatgtggtcagtgccctgggcatcacggcaggagctcatcgactgtgg
agtcatcgaacttacaaagcacggctgcctctgaggatcttcctgatcatggccaacaca
atggctttccagaacgatgtgtatgaatgggcccgagaccatcgtgcccaccacaagttc
tcagagacacacgctgaccctcacaattctcgacgtggctttttcttctctcacgtgggc
tggctgcttgtgcgcaaacacccagctgtcaaagagaagggtggtttgctggacatgtct
gacctcaaagccgagaaactggtgatgttccagagaaggtactataagcctggcctcctg
ttgatgtgtttcatcctgcccacactagttccctggtactgttggggtgaaacttttcta
cacagcttgtatgttgccactttcctgaggtacgctgtggtgctcaatgccacctggctg
gtgaacagtgctgcccacctcttcggatatcgcccttacgataagaacattgaatctcgg
gagaacatcctggtttcactaggagctgtaggcgagggcttccacaactaccaccatgcc
ttcccctacgactactccgccagtgagtaccgctggcacatcaacttaaccacattcttc
attgattgcatggctgccctcggtctagcttatgaccggaagaaagtatccaaggccgct
gtcttggccaggattaaaagaactggagatggaagctacaagagtggttga

DBGET integrated database retrieval system