KEGG   Heterocephalus glaber (naked mole-rat): 101716053
Entry
101716053         CDS       T02812                                 
Symbol
Hras
Name
(RefSeq) HRas proto-oncogene, GTPase
  KO
K02833  GTPase HRas
Organism
hgl  Heterocephalus glaber (naked mole-rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04062  Chemokine signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04144  Endocytosis
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04714  Thermogenesis
hgl04720  Long-term potentiation
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04726  Serotonergic synapse
hgl04730  Long-term depression
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04915  Estrogen signaling pathway
hgl04916  Melanogenesis
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05034  Alcoholism
hgl05132  Salmonella infection
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05207  Chemical carcinogenesis - receptor activation
hgl05208  Chemical carcinogenesis - reactive oxygen species
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05216  Thyroid cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101716053 (Hras)
   04012 ErbB signaling pathway
    101716053 (Hras)
   04014 Ras signaling pathway
    101716053 (Hras)
   04015 Rap1 signaling pathway
    101716053 (Hras)
   04370 VEGF signaling pathway
    101716053 (Hras)
   04371 Apelin signaling pathway
    101716053 (Hras)
   04630 JAK-STAT signaling pathway
    101716053 (Hras)
   04068 FoxO signaling pathway
    101716053 (Hras)
   04072 Phospholipase D signaling pathway
    101716053 (Hras)
   04071 Sphingolipid signaling pathway
    101716053 (Hras)
   04151 PI3K-Akt signaling pathway
    101716053 (Hras)
   04150 mTOR signaling pathway
    101716053 (Hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101716053 (Hras)
   04140 Autophagy - animal
    101716053 (Hras)
   04137 Mitophagy - animal
    101716053 (Hras)
  09143 Cell growth and death
   04210 Apoptosis
    101716053 (Hras)
   04218 Cellular senescence
    101716053 (Hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101716053 (Hras)
   04540 Gap junction
    101716053 (Hras)
   04550 Signaling pathways regulating pluripotency of stem cells
    101716053 (Hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101716053 (Hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101716053 (Hras)
   04650 Natural killer cell mediated cytotoxicity
    101716053 (Hras)
   04660 T cell receptor signaling pathway
    101716053 (Hras)
   04662 B cell receptor signaling pathway
    101716053 (Hras)
   04664 Fc epsilon RI signaling pathway
    101716053 (Hras)
   04062 Chemokine signaling pathway
    101716053 (Hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101716053 (Hras)
   04929 GnRH secretion
    101716053 (Hras)
   04912 GnRH signaling pathway
    101716053 (Hras)
   04915 Estrogen signaling pathway
    101716053 (Hras)
   04917 Prolactin signaling pathway
    101716053 (Hras)
   04921 Oxytocin signaling pathway
    101716053 (Hras)
   04926 Relaxin signaling pathway
    101716053 (Hras)
   04935 Growth hormone synthesis, secretion and action
    101716053 (Hras)
   04919 Thyroid hormone signaling pathway
    101716053 (Hras)
   04916 Melanogenesis
    101716053 (Hras)
  09156 Nervous system
   04725 Cholinergic synapse
    101716053 (Hras)
   04726 Serotonergic synapse
    101716053 (Hras)
   04720 Long-term potentiation
    101716053 (Hras)
   04730 Long-term depression
    101716053 (Hras)
   04722 Neurotrophin signaling pathway
    101716053 (Hras)
  09158 Development and regeneration
   04360 Axon guidance
    101716053 (Hras)
  09149 Aging
   04211 Longevity regulating pathway
    101716053 (Hras)
   04213 Longevity regulating pathway - multiple species
    101716053 (Hras)
  09159 Environmental adaptation
   04714 Thermogenesis
    101716053 (Hras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101716053 (Hras)
   05206 MicroRNAs in cancer
    101716053 (Hras)
   05205 Proteoglycans in cancer
    101716053 (Hras)
   05207 Chemical carcinogenesis - receptor activation
    101716053 (Hras)
   05208 Chemical carcinogenesis - reactive oxygen species
    101716053 (Hras)
   05203 Viral carcinogenesis
    101716053 (Hras)
   05230 Central carbon metabolism in cancer
    101716053 (Hras)
   05231 Choline metabolism in cancer
    101716053 (Hras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101716053 (Hras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101716053 (Hras)
   05225 Hepatocellular carcinoma
    101716053 (Hras)
   05226 Gastric cancer
    101716053 (Hras)
   05214 Glioma
    101716053 (Hras)
   05216 Thyroid cancer
    101716053 (Hras)
   05221 Acute myeloid leukemia
    101716053 (Hras)
   05220 Chronic myeloid leukemia
    101716053 (Hras)
   05218 Melanoma
    101716053 (Hras)
   05211 Renal cell carcinoma
    101716053 (Hras)
   05219 Bladder cancer
    101716053 (Hras)
   05215 Prostate cancer
    101716053 (Hras)
   05213 Endometrial cancer
    101716053 (Hras)
   05224 Breast cancer
    101716053 (Hras)
   05223 Non-small cell lung cancer
    101716053 (Hras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101716053 (Hras)
   05170 Human immunodeficiency virus 1 infection
    101716053 (Hras)
   05161 Hepatitis B
    101716053 (Hras)
   05160 Hepatitis C
    101716053 (Hras)
   05163 Human cytomegalovirus infection
    101716053 (Hras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101716053 (Hras)
   05165 Human papillomavirus infection
    101716053 (Hras)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101716053 (Hras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101716053 (Hras)
   05022 Pathways of neurodegeneration - multiple diseases
    101716053 (Hras)
  09165 Substance dependence
   05034 Alcoholism
    101716053 (Hras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101716053 (Hras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101716053 (Hras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101716053 (Hras)
   01522 Endocrine resistance
    101716053 (Hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101716053 (Hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101716053 (Hras)
   04031 GTP-binding proteins [BR:hgl04031]
    101716053 (Hras)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101716053 (Hras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101716053 (Hras)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101716053 (Hras)
  Exosomal proteins of colorectal cancer cells
   101716053 (Hras)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101716053 (Hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N AAA_16
Other DBs
NCBI-GeneID: 101716053
NCBI-ProteinID: XP_004851779
UniProt: G5C480
Position
Un
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYSIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
CMSCKCVLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagcttgtagtggtgggcgcaggaggtgtgggaaagagcgccctgacc
atccagttgatccagaaccactttgtggacgagtatgatcccaccatagaggactcatac
cggaagcaggtggtcatcgatggggagacgtgcctgctggacatcctggacacagccggc
caggaggagtatagtgccatgcgggaccagtacatgcgcactggggagggcttcctctgt
gtgtttgccatcaataacaccaagtcttttgaggacatccatcaatacagggagcagatc
aagcgggtaaaggactcagatgatgtgcccatggtgctggtggggaataagtgtgacctg
gctgcgcgcactgtggaatctcggcaggcccaggaccttgcccgaagttacagcattccc
tacattgagacatccgccaagacccggcagggtgtagaagatgccttctatacactggtg
cgtgagatccgacagcacaagttgcggaagctgaacccaccagatgagagtgggccgggc
tgtatgagctgcaagtgtgtgctgtcctga

  All links  
Ontology (4)   
   KEGG BRITE (4)   
Pathway (84)   
   KEGG PATHWAY (84)   
Genome (1)   
   KEGG GENOME (1)   
Gene (13)   
   KEGG ORTHOLOGY (1)   
   RefGene (9)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   OC (1)   
Protein sequence (4)   
   UniProt (1)   
   RefSeq(pep) (3)   
DNA sequence (3)   
   RefSeq(nuc) (3)   
Protein domain (12)   
   Pfam (12)   
All databases (121)   

Download RDF
DBGET integrated database retrieval system