KEGG   Heterocephalus glaber (naked mole rat): 101716415Help
Entry
101716415         CDS       T02812                                 

Gene name
Abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101716415 (Abhd12)
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101716415 (Abhd12)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101716415 (Abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 344 aa AA seqDB search
MKWHLGSHVRRKGLWFRLRKLLLCILGLYIAIPFLVRLCPGIQAKLIFLNFVRVPYFIDL
KKPQEQGLNHTCNYYLQPEADVTIGVWHTIPAAWWKNAQGKDQMWYEDALASSHPIILYL
HGNAGTRGGDHRVELYKVLSTLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKAR
SGDNPLYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVVYRYF
PGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYNIAAPSRSF
RDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPDLQH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggcacctggggtctcacgtcaggcggaaggggctgtggttccgactgaggaag
ttgcttctgtgtatcttggggctatacatcgccattccctttctcgtcagactgtgccct
gggatacaggccaaactgattttcttgaattttgtaagggttccctacttcattgacttg
aaaaaaccacaggagcaaggtttgaatcacacctgcaattactacctccagccagaggca
gatgtgactattggagtctggcacactatccctgctgcctggtggaagaacgcccaaggg
aaggaccagatgtggtacgaggatgccttggcttccagccacccgattattctgtacctg
cacgggaatgcgggaaccagaggtggtgaccaccgagtggagctctacaaggtgctgagt
acccttggttaccatgtggtcacctttgactatagaggttggggtgactcagtaggaaca
ccatcagagcggggcatgacctacgatgcactccatgtttttgattggatcaaagcaaga
agtggtgacaaccccttgtatatctggggacattccctgggcactggagtggcgacaaat
ctggtgcggcggctctgtgagcgagagacacctccagatgcccttatattggaatctccg
ttcactaatattcgtgaagaagcaaagagccatccattttcagtggtatatcggtacttt
cctgggtttgactggttcttccttgatcctatcacaagcagtggaattaaatttgcaaat
gatgagaatgtgaagcacatctcctgccccttgcttatcctgcacgcggaggatgaccca
gttgtgcccttccagcttggcagaaagctctacaatattgctgcaccatcgcgaagcttc
cgtgactttaaagtccagtttgtcccctttcactctgacctgggctacaggcacaagtac
atctataagagccctgagctgccacggatcctgagggagttcctggggaaatcggaacct
gacctccagcactga

DBGET integrated database retrieval system