KEGG   Heterocephalus glaber (naked mole rat): 101716969Help
Entry
101716969         CDS       T02812                                 

Gene name
Mmp8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 477 aa AA seqDB search
MLCVKTLLFLFLLHVQPAKTSPIPSENSEEKNAKIAQNYLEKFFYLQREDFRSPDWNSTR
MFVEKLKEMQHFFGLTVTGEPNAETLEIMKKPRCGVPDIGNYMMTPGNPKWKNTDLTYRI
RNYTPQLFQADVETAIEKAFQTWSAASPLTFTRTTEGEADINIAFVQRDHGDNSPFDGPN
GILAHAFQPGQGIGGDAHFDAEETWTISSKGYNLFLVAAHEFGHSLGLSHSSDPGALMYP
NYAFREPSTYSLPQDDINGIQAIYGPSNNPIQPTGPSTPTACDPRLTFDAATTLRGEIFF
FKDKYFWRRHPQLQQVELNFISLFWPSLPNGIQAAYEDSEKDLVFIFKGNQYWVMNGYDI
QQGYPRDISNFGFPSTVQAIDAAVFYKGKTYFFINNQFWRYDNRRQSMDPGYPKCLWSAF
PGIRSKVDAVFQENNFFLFFSGPKYYAFDLTAQRVTRNAEGGEGEKRCKDKNRDWMQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtgtgaagacacttctgtttcttttcttactccacgtgcagcctgccaagacc
tctcccataccttctgaaaactcagaagagaaaaatgcaaagattgctcagaattacctg
gaaaaattcttctacttgcaaagggaggattttcgatctccagattggaacagcactcgt
atgtttgttgaaaagcttaaagaaatgcaacacttttttgggttgactgtgacaggagag
ccaaatgcagaaactctggagataatgaaaaaacctcgctgtggagtgcctgatattggt
aattatatgatgaccccaggaaaccccaagtggaaaaacaccgacctgacctacaggatt
cgaaattataccccacagttgtttcaggctgatgtggaaacagctattgaaaaagccttt
caaacatggagtgctgcatcacccctgaccttcaccagaaccacagagggggaagcagac
atcaatattgcttttgtccaaagagaccatggtgataattctccgtttgatggacccaat
ggaatccttgctcatgcctttcagccaggtcaaggtattggaggagacgctcattttgat
gcagaagaaacatggaccataagctcaaaaggttacaacctgtttcttgttgctgctcac
gaattcggccattccttggggctctctcactcctcagaccctggtgccttgatgtatccc
aactatgctttcagggagcccagcacctactcactccctcaagatgacatcaatggcatt
caggccatctatggaccttcaaataaccccatccaacctactggaccaagcactcccaca
gcctgcgaccctagactgacatttgatgctgctaccacactccgtggagaaatatttttc
tttaaagacaagtacttctggagacggcatcctcagctgcaacaggtcgaactcaatttt
atttctctattctggccatccttgcccaatggtatacaggctgcttacgaggattcagaa
aaagacctagttttcatatttaaaggaaaccaatactgggtaatgaatggctatgacatt
cagcaaggttaccccagggatatatcaaactttggatttccaagcactgtccaagctatt
gatgcagctgttttctataaaggaaagacatacttcttcataaacaatcagttctggaga
tatgataaccgaaggcaatccatggacccgggttatcccaaatgcctatggagtgccttt
ccaggaataagaagtaaagttgatgcggttttccaggagaataacttcttccttttcttc
agtggaccaaaatactatgcatttgatctcactgctcaaagagttactagaaatgcagag
ggaggagaaggagagaagagatgcaaagataaaaacagagattggatgcagtga

DBGET integrated database retrieval system