KEGG   Heterocephalus glaber (naked mole rat): 101717066Help
Entry
101717066         CDS       T02812                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101717066
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     101717066
Cytochrome P450 [BR:hgl00199]
 Cytochrome P450, animal type
  CYP21 family
   101717066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 625 aa AA seqDB search
MLLLLLLVLLLAGTRLLWAQWKLRTLNLPPLAPGFLHLLQPNLPIHLLRLSRKMGPIYRL
HYGLRSERPPSPVPASHGSGPMTPTRVASPTDVVVLNSKQSIEEAMLRKWVDFAGRPQMQ
SSKLVCQSYPDLSLGDYSVLWKAHKKLTRSALLLGARNSMELWVQQLTQEFCQRLRAQAG
APVDIHREFLLLTCGIICGLTFGNKSDTLVRSICSCVQDLMNAWNHWSIQILDMVPFLRV
SCPGRKGGWRSSPPPAADPATSPVPPQPGHPEAEADGGGQGPHRRAAAEAAQGEGCAWTG
LPGPSTRGSPAPRSWPAALPSQDSLVAGQWRDLLDYMLQGVEQPGKEQGSEQLQEGHVHM
SVVDLFIGGTETTATTLSWAVAFLLHHPEIQRRLQEELDLELGPDSFTSRLLYKDRKQLP
LLNATIAEVLRLRPVVPLALPHRTIRPSRWLEGRLLQEGLSGVPASLSLLLPSGSPATTS
PGTLSSSPTSKVPTWTRRCGNGPTSSGLVRREPAGRGEEGWPVLPPLTAPRCSPPPADRF
LPLGKSPHELSFGCGARVCLGESLARLELFVVLTHLLQAFTLLPLEGALPSLQPQPYSGI
NLLVQPFQVRLQPRGLGAPCRGQCQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgctgctcctgctggtgctgctgctggcaggcacccgcctgctgtgggcccag
tggaagctcaggaccctcaacctccctcctctggccccgggcttcctgcacctccttcaa
cccaacctccccatccacctgctcaggctctctcggaaaatggggcccatctaccggctg
cactatgggctgagaagtgagcgccctccctccccagtgcccgccagccatgggtctggc
cccatgacgcccacccgtgtggcttctcctacagatgtggtggtgctgaactccaagcag
tccatagaggaggccatgctccggaagtgggtggactttgccggcagaccccagatgcag
tcctccaagctggtgtgtcagagctaccccgacctgtcactgggggactactccgtgctc
tggaaggcgcacaagaagctcacccgctcggccctcctgctgggtgccagaaactccatg
gagctttgggtgcagcagttgacccaggagttctgccagcgcctgagagcccaggctggc
gcccccgtggacatccacagggagttcttgctcctcacctgcggcatcatctgcggcctc
acctttggaaacaagagtgacaccttggtgcggagcatttgcagctgcgtccaggacttg
atgaatgcctggaaccactggtccatccaaatcctggacatggtccccttcctgagggtg
agctgtcctgggaggaagggcgggtggaggagcagcccccccccagcagctgaccctgcc
acctccccagttcctccccaacccgggcatccagaggctgaagcagatggtggaggtcag
ggacctcatcgtagggcagcagctgaggcagcacaaggtgagggctgcgcctggactggg
ctccctggcccctccaccaggggctccccggcaccccgctcctggcctgctgccctcccc
tcacaggacagcctggtggccgggcagtggagggacctgctggactacatgctccaagga
gtggagcagcccgggaaggagcagggctcggaacagctccaggaaggacacgtgcacatg
tccgtggtggacctcttcatcggcggcaccgagaccacagccaccaccctctcctgggct
gtggccttcctcctgcaccaccctgagattcagcgacgtctccaagaggagctggacctg
gagctgggtcccgactccttcacctcccggctcctgtacaaggaccgcaagcagctgccc
ttgctcaacgccaccatcgctgaggtgctgcgcctgcggcccgtggtgcccttggccctg
ccgcaccgcaccatccgacccagcaggtggctggagggccggctgctgcaggagggcctg
agcggggtccccgccagcctctcactccttctcccctcaggatcgccggctacgacatcc
ccagggacactgtcatcatccccaacatccaaggtgccaacctggacgagacgctgtggg
aacggccccacgagttctggcctggtgcgcagggagcctgccgggcgtggcgaggagggg
tggccggtgctgccgcctctaacagcccctcgctgctctccaccgcccgcagaccgcttc
ctgccgctgggcaagagcccccacgagctgtccttcggctgcggggcgcgcgtgtgcctg
ggtgagtcgctggcccgcctggagctcttcgtggtgctgacgcacctgctccaggccttc
actctgctgccactggagggcgccctgccctctctgcagcctcagccctacagcggcatc
aacctgctggtgcagccttttcaggtgcggctgcagccccggggtctcggggccccgtgc
cggggccagtgccagtga

DBGET integrated database retrieval system