KEGG   Heterocephalus glaber (naked mole rat): 101717308Help
Entry
101717308         CDS       T02812                                 

Gene name
Gbe1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101717308 (Gbe1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101717308 (Gbe1)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101717308 (Gbe1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 701 aa AA seqDB search
MAASAPPASQGKSSEAELAVALADVPELCHLLENDPYLKPYATDFQRRYKKFSHILNNFG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGEFSGWNPFSYPYKKLDYG
KWELYIPPKQNKFVIVPHGSKLKVVITSKSGEILYRISPWAKYVVREGTNVNYDWIHWDP
EHPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTCNVLPRIKDLGYNCIQLMAV
MEHAYYASFGYQVTSFFAASSRYGTPEDLKELVDTAHSMGIIVLLDVVHSHASKNAEDGL
NMFDGTDSCYFHSGPRGTHELWDSRLFAYSSSAKLLMTVHNRDWFVLSSVGIENFDKSVT
HKESRNFQSQSFSGDYNEYFGLQVDEDALVYLMLANYLIHTLYPDSITIAEDVSGMPALC
SPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVHTLTNRRHLEKCIAYAESHD
QALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHALGGEGYLNFMGN
EFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKHLNNFDRDMNRLEERYGWLSAPQ
AYVSEKHEGNKVITFERANLLFIFNFHPSKSFTDYRVGTALPGKYKIVLDSDATEYGGHQ
RLDHNTDFFSEPFEHNGRHYSLLVYIPSRVALILQNVDLPN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccgcacctccagcttctcagggcaagtcctcggaagcggagctcgctgtc
gccttggcggacgtgcccgaactgtgccaccttctggagaatgacccgtatctgaagccc
tacgccacggacttccagcgcaggtataagaagtttagccacattttgaacaactttgga
gagaatgaaggtggtattgataagttttccagaggctatgaatcatttggcgttcacaga
tgtgctgatggtggcttgtattgcaaagaatgggccccaggagcagaaggagtttttctt
actggagagtttagtggctggaacccattttcatacccttataaaaaactggattatgga
aaatgggagctgtatatccctccaaaacagaataaatttgtaatcgtaccacatggatcc
aaattaaaggtagttattactagtaaaagtggagagatcttgtatcgtatttcaccatgg
gcaaagtatgtggttcgtgaaggtactaatgtgaattacgattggatacactgggatcct
gaacacccatacaaatttaagcattccagacccaagaagccaagaagcctgagaatttat
gaatctcatgtgggaatttcttcccatgaaggaaaaatagcttcttataaacattttaca
tgtaatgtactaccaagaatcaaagaccttggatacaactgcattcaattgatggcagtc
atggagcatgcttattatgccagttttgggtaccaagtcacaagcttttttgcagcttca
agtcgctatggaactcctgaagacctaaaagaacttgttgacacagctcattcaatgggt
atcatagtcctcttagatgtggtgcatagtcatgcttccaaaaatgcagaagatggattg
aatatgtttgatgggaccgattcctgttatttccattctggacctagagggactcatgag
ctttgggatagtagattgtttgcttactccagctctgctaaattactaatgacagttcat
aacagagattggtttgtcctttcttcagttggtatagagaactttgacaaatctgtcacc
cataaggaatccaggaatttccagagtcagagtttttcaggtgattataatgaatatttt
ggactacaagtagatgaagatgccctggtttatctcatgttggcaaattatttgattcac
acattgtatccagattccataacaatagctgaggatgtgtccggaatgccagctctgtgt
tctcccatttcccagggagggggtggttttgactatcggttagccatggcaattccagat
aaatggattcagctacttaaagaatttaaagatgaagattggaatatgggcaatatagta
catactctcacaaatagacgccaccttgaaaagtgcattgcttatgcagagagccatgat
caggcactggtaggtgataagacattggcattttggttgatggatgctgaaatgtataca
aacatgagtgttctagctccttttactccagttattgatcgtggaatacagcttcataaa
atgattcgacttattactcatgctctcggtggagaaggctatctcaatttcatgggcaat
gaatttgggcatcctgaatggttagacttcccaagaaaaggaaacaatgagagttaccac
tatgccagaaggcagtttcatttaactgatgatgaccttcttcgatataaacacctaaat
aactttgacagggatatgaatagattggaagaaagatatggttggctatcagctccacag
gcctatgtgagtgaaaaacatgaaggcaataaggtcatcacttttgagagagcaaatctt
ctttttattttcaactttcatccaagcaagagtttcactgattaccgagttggaacagca
ttgccaggaaaatacaaaattgtgctagactcagatgcaacagaatatggaggacaccag
agactggaccacaatacggatttcttctctgagccttttgagcataatggccgtcactat
tctcttttggtgtacattccaagccgcgtggccctcatccttcagaatgtggatctgcca
aactga

DBGET integrated database retrieval system