KEGG   Heterocephalus glaber (naked mole rat): 101717730Help
Entry
101717730         CDS       T02812                                 

Gene name
Comt
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101717730 (Comt)
  Amino acid metabolism
   00350 Tyrosine metabolism
    101717730 (Comt)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101717730 (Comt)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101717730 (Comt)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101717730 (Comt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 270 aa AA seqDB search
MLEASPLLLVAASLGIVLLAFLLILRHWGWAVLLIYWYEFILQPVKHLIMGDTKEQRILR
HVQEHAKPGDPQSVLEAIDDYCSHKEWAMNVGNKKGEIMDGVIRELGPSLVLELGAYCGY
SAVRIARLLPPGGRLFTMEINPNFTVITQQMLDFAGLQDKVTVLLGASQDLIPQLKKKYD
VDTLDMVFLDHWKDRYLPDTHLLKECGLLRKGTVLLADNVIVPGAPEFLKYVRGSSSFEC
THYSSYLEYMKVVDGLEKAVYKGXGSPVPS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggcctcacctctgctgttggtagctgcctcattgggcattgtgctgttggcc
ttcctgctgatattaagacactggggctgggccgtgttactcatatattggtatgagttc
attctgcagccagtcaaacatctgattatgggagacactaaggaacagcgtatcctgcgc
catgtgcaagagcatgcaaagcctggggacccccagagcgtgctggaagccattgatgat
tattgctcccacaaggagtgggccatgaacgtgggcaacaagaaaggtgagatcatggat
ggtgtgattcgggagcttggcccctccctagtgctggaactgggggcctactgtggctac
tcagctgtgcgcatagcccgcctgctgccacctggtgggcggttgttcactatggagatc
aaccccaactttactgtcatcacccagcagatgctggacttcgcgggcctgcaggacaag
gtcactgtcctgcttggggcgtcccaggaccttatcccccagctgaagaagaagtatgat
gtggacacgctggacatggtcttcctcgaccactggaaagaccgctacttgccagacacc
catctcctgaaggaatgtggcctgttgcggaaggggacagtacttctggctgacaatgtc
atcgtcccaggagcaccagaattcctgaaatatgtacgtgggagcagcagctttgaatgc
acacactatagctcttacctggagtacatgaaggtggtggatggcctggagaaggctgtc
tacaaaggctaaggcagtccagtgccgtcttaa

DBGET integrated database retrieval system