KEGG   Heterocephalus glaber (naked mole rat): 101718025Help
Entry
101718025         CDS       T02812                                 

Gene name
St6gal1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00510  N-Glycan biosynthesis
hgl00514  Other types of O-glycan biosynthesis
hgl01100  Metabolic pathways
Module
hgl_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101718025 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    101718025 (St6gal1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     101718025 (St6gal1)
Glycosyltransferases [BR:hgl01003]
 Terminal extension
  Sialyltransferase
   101718025 (St6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 DUF2079
Motif
Other DBs
NCBI-GeneID: 101718025
NCBI-ProteinID: XP_004834869
UniProt: A0A0P6J4D7
Position
Un
AA seq 405 aa AA seqDB search
MFHTNLKKKFSYCILVFLLFAVICVWKERKKGSYYGSLKVQTKEFQVLKSLKKLSMGSGS
RSMSSSSTQLPHRLTQTLSPRVPSKAKLQPTFQVWNKDSSSKNLVPRLQSIRKNYLRMNK
YKVSYKGPGPGVKFSAEALRCHLRAHVNVSMVEATDFPFNTSEWEGYLPRENIRTKAGPW
HRCAVVSSAGSLKSSQLGQEIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEG
RFLRDSLYSEGILIVWDPSMYHADIPKWYQNPDYNFFNNYKSYRKLHPDQPFYILRPQMP
WELWDVLQEISPEEIQPNPPSSGMLGIILMMTLCDQVDVYEFLPSKRKTDVCYYHQKFFD
SACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNLRC
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacaccaacctgaagaaaaaattcagctactgtatcctggtctttctcctgttt
gcagtcatctgtgtgtggaaggaaagaaagaaagggagttactatggctcccttaaagtg
caaaccaaggaattccaggtgctcaagagccttaaaaaactgtccatggggtctggttcc
cggtctatgtcatcaagcagtacccagctcccccaccggctcacccagaccctcagtccc
agggtcccatccaaggccaaactgcagcccaccttccaggtgtggaacaaagacagctca
tccaaaaaccttgtccccaggctgcaaagtatccggaagaattatcttcgcatgaacaag
tataaagtatcctataaggggccggggccaggcgtcaagttcagtgcagaggctctgcgc
tgccacctccgggcccatgtaaacgtatccatggtggaagccacagattttcccttcaat
acctctgaatgggagggttacctgcccagggagaacattaggaccaaggctgggccgtgg
cacaggtgtgctgttgtctcatcagcgggatctctgaagtcctcacaactgggccaagaa
atagatgatcacgatgcagtcctgaggtttaatggcgcacccacagccaacttccaacaa
gatgtgggcacgaaaactaccattcgcctgatgaactctcagttggtcaccacagaaggg
cgcttcctcagggacagtttgtacagtgaaggaatcctgattgtgtgggacccgtccatg
taccatgcagatatcccaaagtggtaccagaatcccgactacaatttctttaataactat
aagagctatcgcaagctgcaccccgaccagcccttttacatcctcagaccccagatgcct
tgggagctgtgggatgttcttcaggaaatctccccagaagagatccagccaaatccccca
tcctctgggatgctcggtatcatcctcatgatgacgctgtgtgaccaggtggacgtttat
gagttcctcccatccaagcgcaagactgacgtgtgctactaccaccagaagttctttgac
agcgcctgcacgatgggtgcctaccacccactcctttttgagaagaatatggtgaagcac
ctcaacgagggcacagatgaagacatctacctgtttgggaaagccacactgtctggcttc
cggaaccttcgctgctga

DBGET integrated database retrieval system