KEGG   Heterocephalus glaber (naked mole rat): 101718202Help
Entry
101718202         CDS       T02812                                 

Gene name
Art3
Definition
ADP-ribosyltransferase 3
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101718202 (Art3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 417 aa AA seqDB search
MLLTQKRKMKTGHFEMVTMLLAAVILMDIFQVKAEILDMADNVFDDEYLKCTDRMEMKYV
PQLLKEEKANHQLLETVWENAKAKWESQKPQLFLPTKFQDNHGIALMTYISEAKEQTPFY
HLFNEAVKMAGQSRKDYIYGFQFKALHFYLTRALQLLRRPCEDSYKNVVYKTSQDTSFTF
GGQNQARLGNFTLAYSAKPEVANDQHIVLTIYTCFGVDVEKFFGKESERITLIPLSEVFQ
VSQEKAGNNLILHSTNKTCSHYECAFVGGLKSENCAENLEYSQPIYVYNPDRYSPCQCGS
SQRLKGPIRSTWNSSGEENQKLEDPGVKIHELPEIPGMKTPEPSPLPEIKVVQLDENFED
RHRGNMDNPTPGPGPGPVPVPGPKTHPSASSGNMFLPLLGAFIILISTSAVNLFIVR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttacccagaaaagaaaaatgaagacaggacattttgaaatggtcaccatgctc
ctggcagccgtgattctaatggacatcttccaggtgaaggctgaaatattagacatggca
gataatgtatttgatgatgagtacctgaaatgtactgacaggatggaaatgaaatatgtt
ccccaactgctcaaggaagaaaaagcaaatcatcaactcttggagactgtgtgggaaaat
gcaaaagccaaatgggaatcccagaagcctcagctgtttctccctacaaagtttcaggat
aaccatggaatagccctgatgacatatatttctgaagctaaagagcaaactcctttttac
catcttttcaatgaagctgtgaaaatggctggccagtcacggaaagattatatctatggc
ttccagttcaaagctttgcatttttacctcacaagagctctgcagttgctaagaagacct
tgtgaagacagttacaaaaatgtggtatataagacaagccaggacacttcatttacattt
ggagggcaaaaccaagccagacttggcaatttcacattggcatattctgccaaacctgaa
gtagctaatgaccaacacattgttttaactatctacacatgttttggagttgatgttgaa
aaattttttggtaaagaaagtgaaagaattactttaatacccctgagtgaagtttttcaa
gtgtcacaggaaaaggctggcaataaccttatccttcacagcacaaacaagacttgcagc
cattatgagtgtgcatttgtaggtggactaaagagtgaaaattgtgctgaaaacttagaa
tatagtcagcccatctatgtctacaaccctgacagatacagtccatgccaatgtggctcc
agtcaaaggctgaaaggacccataagaagtacctggaatagctctggtgaagaaaaccag
aagcttgaagaccctggtgtgaaaatccatgaactccctgaaatacctggaatgaaaact
ccagaaccttctccactacctgaaataaaagtggtacaactggatgaaaactttgaagac
agacatcgaggaaacatggataatcctactccaggtccaggtccaggtccagttcctgtt
ccaggtcccaaaacccatccttctgcatcctctggcaatatgttccttccactgcttggg
gcattcatcattttaatcagcacttctgctgtaaatctctttatagttagatag

DBGET integrated database retrieval system