KEGG   Heterocephalus glaber (naked mole rat): 101718538Help
Entry
101718538         CDS       T02812                                 

Gene name
Uchl3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 294 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSVVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNRDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTESSSPSSSQPHSSHCRTKASSLC
HHASLPWVKRNHVGPAKATSPSLRLRRWRPFLRLPSLGLHSVAPNIDEKVDLHFIALVHV
DGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaggggcagcgctggttgccgctggaggccaaccctgaggttaccaaccagtttctc
aaacaattaggtctacatcctaactggcaatttgttgatgtatatggaatggatcctgaa
ctccttagcgtggtaccaagaccagtctgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaggatgtt
acatcatcagtgtatttcatgaagcagaccatcagcaatgcctgtggcacgattggactg
attcatgctattgcgaacaatagagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggagtctgtgtcaatgagccctgaagaacgagccagatacctggagaac
tatgacgctattcgagttactcatgagaccagtgcccacgaaggtcagactgagtcctcc
tcgccatcttcatcacagcctcattctagccactgcagaacgaaggcctcatcattgtgt
caccatgcatccctgccctgggtcaaacgtaaccatgtaggccctgcaaaggctaccagt
ccatctctccgtcttcgtcgctggcgacccttcttacgcctaccatctttgggtctccat
tctgttgcaccaaatatagatgaaaaagtagaccttcattttattgcattagttcatgta
gatgggcatctctatgaattagatgggcggaaaccatttccaattaaccatggggaaact
agtgatgagactttactagaggatgccatagaagtttgcaagaagtttatggaacgtgac
cctgatgaactaagatttaacgcaattgctctttctgcagcatag

DBGET integrated database retrieval system