KEGG   Heterocephalus glaber (naked mole rat): 101718538Help
Entry
101718538         CDS       T02812                                 

Gene name
Uchl3
Definition
(RefSeq) ubiquitin C-terminal hydrolase L3
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101718538 (Uchl3)
Peptidases [BR:hgl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101718538 (Uchl3)
Ubiquitin system [BR:hgl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    101718538 (Uchl3)
  UBL-specific proteases (ULPs)
   101718538 (Uchl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSVVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNRDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPNIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaggggcagcgctggttgccgctggaggccaaccctgaggttaccaaccagtttctc
aaacaattaggtctacatcctaactggcaatttgttgatgtatatggaatggatcctgaa
ctccttagcgtggtaccaagaccagtctgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaggatgtt
acatcatcagtgtatttcatgaagcagaccatcagcaatgcctgtggcacgattggactg
attcatgctattgcgaacaatagagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggagtctgtgtcaatgagccctgaagaacgagccagatacctggagaac
tatgacgctattcgagttactcatgagaccagtgcccacgaaggtcagactgaggcacca
aatatagatgaaaaagtagaccttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatgggcggaaaccatttccaattaaccatggggaaactagtgatgagact
ttactagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaacta
agatttaacgcaattgctctttctgcagcatag

DBGET integrated database retrieval system