KEGG   Heterocephalus glaber (naked mole rat): 101718541Help
Entry
101718541         CDS       T02812                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hgl00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MGAQLSTLGRVALSPVWFLYSLFMKLFQRSRPAITLESPDIKYPLRLIDREVVSHDTRRF
RFALPSPQHILGLPIGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPNGLLVYQGRGKFGIRPDKKSSPVTKTAKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNAHSTRFKLWYTLD
RAPEGWDYSQGFVNEEMIRDHLPAPGEETLVLMCGPPPMIQFACLPNLERLGHAKERCFT
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctgagcacgttggggcgtgtggcgctctcgccggtctggttcctctac
agcctgttcatgaagctgttccagcgctccaggccggccatcaccctcgagagtcccgac
atcaagtacccgctgcggctcattgacagggaggtcgtcagccatgacacccggcgcttc
cgctttgccctgccatccccacagcacatcctgggcctgcccatcggccagcacatctac
ctctcggctcgaattgatgggaacctggtcatccggccctacacgcccgtttccagtgac
gatgacaagggttttgtggacctggtcatcaaggtctacttcaaggacacccatcccaag
tttcctgctggggggaagatgtcccagtacctggaaagcatgcagattggagacaccatt
gagttccggggccccaatgggctgctggtgtaccagggcagagggaagttcggcatccgg
cccgacaagaagtccagccctgtgaccaagacagccaagtcggtgggcatgatcgcagga
gggacaggcatcacacccatgctgcaggtgattcgtgccatcatgaaggacccggatgac
cacaccgtgtgccacctgctctttgccaaccagactgagaaggacatcctgctgcggcca
gagctggaggagctgaggaacgcacattccactcgcttcaagctgtggtacacactggac
agggcccccgagggctgggactacagccagggctttgtgaacgaggagatgatccgcgac
cacctcccggcgccgggtgaggagacgctggtgctgatgtgtgggccaccacccatgatc
cagtttgcctgcctgcccaacctggagcgcctgggccatgccaaggagcgctgcttcacc
ttctga

DBGET integrated database retrieval system