KEGG   Heterocephalus glaber (naked mole rat): 101718884Help
Entry
101718884         CDS       T02812                                 

Gene name
Art4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101718884 (Art4)
Cellular antigens [BR:hgl04090]
 Proteins
  101718884 (Art4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MLLVASHQQKSQHGQAQRRFSLRLTQRNHGRRSLRAHFRMKLQGKRCTLNTNKNYPWISR
CKWILLPATASPVIRMRLQGGQLALLLLLCGLQTPTGHAEVTIKVDFDLAPDSFDDQYQG
CSKQVMEELSQGDYFTEEIDAHKHYFRVWHKAHLTWLSREKALPKNMTDTHAVALLVYTS
NSQVRSDFATAMASAARSPQQYKRSFHFKYLHYYLTSAIQLLRTQLSTKSHTLCYEVHHG
MKDIHFVANVGDTVRFGQFISTSLLREEAQKLGRKTLFTIFSCLGAPVQDFSLQKEVLIP
PYELFEVVNTSYHPNGNWLQLQSTGNLSIYNCQLLKASSEKCIPTPIVIASLYFLATVII
SSKSRV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctcttagttgctagtcatcaacagaagtctcagcacggacaggcacaaagaaggttc
tcactgagactcactcaaagaaaccacggaaggagaagtctgagggctcatttcaggatg
aagcttcaagggaaaagatgcactttgaacacaaacaaaaattatccatggatcagcaga
tgcaagtggattcttctcccagctactgccagtcctgtgatcaggatgaggctccaaggt
ggacagctggcactcctgctgctgctctgtggcctgcagacacccacggggcacgctgag
gttacaattaaagtcgactttgatttggcaccagactccttcgatgatcaataccaaggc
tgtagcaaacaggttatggaggagctaagtcaaggagattatttcacagaggaaatagat
gcccataaacattacttcagggtgtggcacaaagcccacttaacctggctgagtcgagaa
aaagctctccccaagaacatgacagatacacatgctgtggctctcttggtttacacatca
aatagccaggtgcgctccgactttgccactgccatggccagtgctgccaggtctccacag
cagtacaaacgttcattccatttcaaatatctacactactacctgacctcagcaatccag
ctgctgaggacacaactcagcacgaagagtcacactctgtgttatgaggtacaccatggc
atgaaggacatccactttgtagccaacgtaggtgacactgttcgatttggccagttcatt
tccacctccctcctaagagaagaggcacaaaagttggggagaaaaacactatttaccata
tttagctgcctaggtgcacctgtgcaagacttctccctccagaaggaagtcctgatccct
ccctatgagctgtttgaagttgtaaatacaagctaccacccaaatggaaactggttgcaa
ttgcagtcgaccgggaacctgagcatatacaactgccagctgctaaaagcttcgagcgag
aaatgcatccctactcctatagttattgcatctctctacttcttggccaccgttatcatc
tcttccaaaagcagagtgtag

DBGET integrated database retrieval system