KEGG   Heterocephalus glaber (naked mole rat): 101719016Help
Entry
101719016         CDS       T02812                                 

Gene name
Pomt1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101719016 (Pomt1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101719016 (Pomt1)
Glycosyltransferases [BR:hgl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101719016 (Pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 614 aa AA seqDB search
MLLESPLIFFNLLAVLSYLKFFNCQKHRPFSLPWWFWLMLTGVACACAVGIKYMGIFTYL
LVLGVAAVHAWHLIGDQTLSNVLVLYHLLARAVALLVTPVTLYLLFFYIHLTLLCRSGPH
DQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNIFGKPLPCWLHSHQNTYPIIYEN
GRGSSHQQQVTCYPFKDVNNWWVVKDPGRHQLVVSNPPRPVRHGDVVQLVHGMTTRFLNT
HDVAAPLSSHAQEVSCYVDYNISVPAQNLWRLDIVNRQSDRDTWKTILSAVRFVHLNTSA
VLKLSGAHLPDWGFRQLEVVGEKLSRGHHESMAWNVEEHRYGTSECGLGPAPVCPRGQAL
LRATGLRVARNSGSVPALMELCLPGQEQRDRELELHAPTQVDVSRNLSFMARFSELQWRM
LTLRGEDAEHKYSSTPLEWVTLDTSIAYWLHPRTSAQIHLVGNIVIWASASLATATYVLL
FLWYLLRRRRDVHDLPEDVWLHWVLAGTLCTGGWALNYLPFFLMEKTLFLYHYLPALAFQ
LLLLPLVLQHVYDHLCRSRVQRHLFSTLVVAWYSVACHVSNKLRPLTYGDSSLTPGELLA
LRWRDSWDILIRKS
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagtcaccgttaatatttttcaatctcttggctgtgctgtcctatctgaag
ttcttcaactgccaaaaacacaggcctttctctctgccctggtggttctggctgatgctg
acaggggttgcctgcgcctgcgccgtaggcatcaaatacatgggcatcttcacctacttg
ctcgtgctgggcgtcgcggctgtccacgcttggcacctgatcggagaccagactctgtcc
aacgtccttgtgctctaccacttgctcgccagagcagtggccctgttggtcaccccggtc
accctgtacttactgttcttctacatccacttgacactgctctgccgctctggaccccat
gaccaaatcatgtcgagcgccttccaggccagcttggagggaggactggcccgcatcacc
caagggcagcccctggaggtggccttcggctcgcaggtcacgctgaggaacatcttcggc
aagcccctgccctgctggcttcactcccaccagaacacctaccccataatctatgagaat
ggccggggcagctcccaccagcagcaggtgacctgctaccccttcaaggatgtcaacaac
tggtgggtcgtcaaggaccccgggaggcaccagctggtggtgagcaacccgcccaggccc
gtgcggcacggggacgtggtccagctggtccatggcatgaccacgcgcttcctaaacacg
cacgatgtcgccgccccgctgagctcccacgcgcaggaggtgtcctgctacgtggactac
aacatctccgtgcccgcccagaacctctggaggctggacatcgtgaacaggcagtcggac
agggacacctggaagaccatcctatcagccgtgcgcttcgtgcacctgaatacttctgct
gtgctcaagctgagcggggcgcacctccccgactggggctttcggcagctggaggtggtg
ggtgagaagctgtcgcggggccaccacgagagcatggcgtggaacgtggaggagcaccgc
tacggcaccagtgagtgtggcctgggtccagcgcctgtgtgtccccgtgggcaggccttg
ctgagggccacagggctccgtgtggccagaaactcgggctccgtcccggccctgatggag
ctgtgtctcccaggccaggagcagagggaccgggagctggagctgcatgcgcctacgcag
gtggacgtcagcaggaacctcagcttcatggccagattctcggaactgcagtggaggatg
ctgacgctgcggggcgaggacgcagagcacaagtacagctccacacccctggagtgggtc
acgctggacaccagcatcgcctactggctgcaccccaggaccagtgctcagatccacctg
gtcgggaacatcgtgatctgggcctcggccagcctggccacagccacctatgtgctgctc
ttcctgtggtacctgctcaggcggcggagggatgtccacgacctccctgaggacgtgtgg
ctgcactgggtgctggctgggaccctgtgcactggcggctgggcactgaactacttgccc
ttcttcctgatggagaagacgctcttcctctaccactacctgcccgcactcgccttccag
ctgctcctgctcccactcgtcctgcagcacgtctatgaccacttgtgcaggtcccgggtg
cagcgccacctcttcagcaccctggtcgtagcctggtactcggtcgcctgccacgtgtcc
aacaagctgcgcccactgacctacggtgacagctcgctgaccccaggagaactcctggcc
cttcgctggagagacagctgggacatcctgatccggaaatcctag

DBGET integrated database retrieval system