KEGG   Heterocephalus glaber (naked mole rat): 101719027Help
Entry
101719027         CDS       T02812                                 

Gene name
Gba2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hgl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hgl00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 919 aa AA seqDB search
MGTDVPASEQISCAKGYPQVYCPKDTGGTAAVRVTHREILEDIRPQNEPSYCSPEDFGQL
MDSYEGKARGYQVPSFGWRICLAHEFAEKRKPFQANNISLSNLVKHLGMGIRYLKWWYRK
TQVEKKKPFIDMINCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGIYQHQTVIAD
QFTVCLRREGRTVYQQVLSMERPSVLHSWNWGLCGYFAFYHALYPRAWTVYQLPGQNITL
TCRQITPILPHDYEDSSLPVGVFVWDVENEGDEAVDVSIMFSMRNGLGGEDDAQGGLWNE
PFCLEQDGETVQGLLLHHPTLPNPYTMAVAARLTEDSTVTHITAFDPDSTGHQVWQDLLQ
DGQLDSPAGRSNPSQKGAGIAGALCVSGKLPPRGRCSLEFSLAWDMPRIMFGAKGQVHYR
RYTRFFGPDGDAAPALSHYALCHYADWEDRISAWQSPVLDDRSLPAWYKSALFNELYFLA
DGGTVWLEVPEDSLPEELVGSMGQLRPILREYGRFGYLEGQEYRMYNTYDVHFYASFALV
MLWPKIELSLQYDMALATLREDLTRRRYLMSGVMGPVKRRNVIPHDIGDPDDEPWLRVNA
YLIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDHDGLIEN
GGYADQTYDGWVTTGPSAYCGGLWLAAVAVTVQMAVLCAAQDVQDKFSSILSRGQEAYER
LLWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTTHVVRALQTIFEL
NVQSFAGGAMGAVNGMQPHGIPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGC
YRTVWERLGLAFQTPEAYCQQQVFRSLAYMRPLSIWAMQLALQQQKHKKASSLIVNQGTG
LSTEPKCGPKEASANLTPE
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgacgtgccagcgtcggagcagatcagctgtgccaaaggttatccacaagtt
tattgccctaaagatactggaggcaccgcggctgtgcgggttacacaccgggagatcctt
gaggacattagaccccaaaatgaaccaagctactgcagtccggaagactttgggcagctg
atggattcctatgagggtaaagctaggggctaccaggtgccttcctttggttggcgcatc
tgcctggctcacgagtttgcagagaagaggaaaccctttcaagctaacaatatctcccta
agcaacctggtaaagcacttgggcatgggtatcaggtacttgaagtggtggtaccggaag
acccaggtggaaaagaagaaacctttcatcgatatgatcaattgtgtgcccctgagacag
atctatggttgtcccctgggtggcattggtggaggtactattacccgtggctggagaggc
cagttctgtcgttggcagcttaacccaggaatataccagcaccagacagttatcgctgac
cagtttacagtgtgcttgcgtcgggagggacggactgtgtaccagcaagttctgtccatg
gagcgtccaagtgtcctgcacagctggaactggggcctgtgtggctactttgctttctac
cacgccctctatccccgagcctggactgtctatcagcttcctggccagaatatcaccctc
acttgtcgccagatcacacccatcttgccccatgactacgaggacagcagcctgcctgta
ggagtctttgtgtgggatgtagaaaacgaaggggatgaagctgtggatgtatccatcatg
ttctccatgcgaaatggcctggggggtgaagacgatgcccaggggggtttatggaatgag
cccttctgtctggagcaggatggggaaactgttcaagggctgctgctgcatcatccaacc
cttccaaatccttacaccatggctgtggctgcgcgactcacggaagattccacggtaacc
cacatcacagcctttgatcctgacagcactgggcaccaggtgtggcaggacctacttcag
gatggacagctggactcccccgctggccgaagcaacccctcacagaaaggagcaggcatc
gctggggctctgtgtgtttcaggcaagctgccacctcgaggccggtgctccctggagttt
tcactggcttgggacatgcccaggatcatgtttggagctaaggggcaagtccactacagg
aggtacacaaggttctttggcccagatggtgatgcagctcctgcccttagccactacgca
ttgtgccactatgcagactgggaagacaggatctcagcatggcagagcccagtattagat
gacagatccttacctgcctggtacaaatctgcactattcaatgaactatactttctggcg
gatgggggcacagtgtggcttgaagttcctgaagactccctaccggaggagctggtagga
agtatgggtcagcttcgtcccatccttcgggaatacggtcgatttggctatcttgagggc
caagagtatcgcatgtacaacacatatgatgtccacttttatgcttcctttgccctcgtt
atgctctggcccaaaattgagctcagcctacagtatgacatggctctcgcaaccctcagg
gaggacctgacacgtcgacggtacctgatgagtggggtaatgggacctgtgaaaaggaga
aatgtcattccccatgatattggggacccagatgatgagccgtggctccgggtcaatgca
tatttgatccatgatactgctgactggaaggacctgaacctgaagtttgtgctgcaagtt
tatcgagattattacttgacgggcgaccaaggcttcctgaaggacatgtggcctgtgtgt
ctagccgtgatggaatctgaaatgaagtttgacaaggaccatgacggactcattgagaat
ggtggctatgcagaccagacctatgatggatgggtcaccacaggccccagtgcttactgt
ggagggctgtggctggcagctgtggctgtgacggtccagatggctgttctatgtgcggca
caggatgtccaggataagttttcttccatcctcagccggggccaggaagcctatgagaga
ctgctgtggaatggccgctattacaactatgatagcagctctcagcctcagtctcgaagt
gtcatgtctgaccagtgtgctgggcagtggttcttgaaggcctgtggcctaggagaagga
gacactgaggtatttcctaccacacatgtggtccgtgctctccagactatcttcgagctc
aatgtccagtcctttgctggaggggccatgggagctgtgaatggaatgcagccccatggt
atccctgatagatccagtgtgcagtctgatgaagtctgggtgggtgtggtctatggcctg
gcagccaccatgatccaagagggcctgacatgggagggcttccagacagctgaaggctgt
tatcgtactgtgtgggagcgccttggcctggctttccagaccccagaggcatactgccag
cagcaggtattccgctcactggcctacatgcgcccgctgagtatctgggccatgcaactg
gccctgcaacagcagaagcataaaaaagcctccagtctgatagtcaatcagggcacagga
ctaagcacagagcctaaatgtggaccaaaggaagcctcggcaaacctaaccccagagtaa

DBGET integrated database retrieval system