KEGG   Heterocephalus glaber (naked mole rat): 101719951Help
Entry
101719951         CDS       T02812                                 

Gene name
Gls
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101719951 (Gls)
   00330 Arginine and proline metabolism
    101719951 (Gls)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101719951 (Gls)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101719951 (Gls)
  Nervous system
   04724 Glutamatergic synapse
    101719951 (Gls)
   04727 GABAergic synapse
    101719951 (Gls)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101719951 (Gls)
   05206 MicroRNAs in cancer
    101719951 (Gls)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101719951 (Gls)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 641 aa AA seqDB search
MMRLRGAALLRDLLLRPPVAVGAALRRAQPLVTLCRRPRLGARPAACPAASRLHPWWGGG
GGRPSGPRAGALSSSPSEILPELGKGGAQPQPGASPPAAPQSPGPKDGPGEKDALGHGEG
KELMAAGDNKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMAFTSHIDELFESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMDKMGNSVKGIHFCHVKSVINLLFAAYTGDVSA
LRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEAL
HFGHHDVFKILQEYQTQYTPQGDADSGKENQTVHKNLDGLL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcggggcgcggcgctgctgcgcgacctgcttctgcggccgcccgtcgcc
gtcggcgcggccctgcggcgggcgcagcccctcgtcacgctgtgccggcgcccccggctc
ggggcccggccggctgcgtgcccggcggcctcgcggctgcacccgtggtggggcggaggc
ggcgggcggccgtcggggccgcgcgcgggagccctgtccagctcgccctcggagatcctg
ccggagctgggcaaggggggcgcgcagccgcagcccggggcgtcgccgcccgccgccccg
cagagccccggccccaaggacggccccggggagaaggacgccctgggccacggcgagggc
aaagagctgatggccgctggcgacaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcagaaggacaagaaaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacgtcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgctgacacaagcctttagaagaaagtttgtc
attcctgactttatggcctttacctcacacatcgatgagttgtttgaaagtgcaaaaaag
cagtctggaggaaaggttgcagattatatccctcaactggccaagttcagtcctgattta
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
cccttttgtctgcagtcctgtgtaaaacctttgaaatacgcaattgctgtcaatgatctt
ggaactgaatatgtgcatcgctatgttggaaaagagccaagtggattaagattcaacaaa
ctatttttaaatgaagatgataaaccacacaaccctatggtaaatgctggagccattgtt
gtcacttcattaataaagcagggagtaaataatgctgaaaaatttgactatgtgatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgccacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatactacttgaaagaaaagaagtgt
tttccagaaggcacagacatggtgggaatactagacttctatttccagctgtgctccatc
gaagtgacttgtgaatcagccagtgtgatggctgcaaccctggccaatggtggcttttgc
ccaatcactggtgaaagagtcctgagtcccgaagccgttcggaacacactgagtttgatg
cattcctgtggcatgtatgatttctcagggcagtttgcttttcatgttggtcttcctgcg
aaatctggagttgccggaggcattcttttagttgtcccgaatgtcatgggcatgatgtgc
tggtctcctcctctggacaagatggacaagatgggcaacagtgttaaagggattcacttc
tgtcatgtcaagtcagtgataaaccttttgtttgctgcgtacactggagatgtgtccgct
cttcgaagatttgcgttgtcggccatggatatggaacagcgggactacgattccagaaca
gcactccatgtagctgctgcagagggtcacgttgaagttgttaaatttttgctggaagct
tgcaaagtaaatcctttccccaaagacaggtggaataacactcccatggatgaagctttg
cactttggacaccatgatgtgtttaagatcctccaggaataccaaacccagtacacacct
caaggagatgccgacagtggaaaggaaaatcaaaccgtccacaagaatcttgatggattg
ttataa

DBGET integrated database retrieval system