KEGG   Heterocephalus glaber (naked mole rat): 101720761Help
Entry
101720761         CDS       T02812                                 

Gene name
Kat6b
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101720761 (Kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2058 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSASHGLDKKTVSEQLELSVQDGSV
LRVTNKGLASYKDPDNPGRFSAVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLD
GKAKAAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCA
DCGSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHME
CCDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTS
DEGSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTST
YISASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHV
LATGTTQKLKPPPSSLPPPNPISGQSPSSQKSNTSTSSTSPQSSSSQSSVPSFSSLTNNS
QLKALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTDLSSTAKSKAHFFGKRDIRSRFI
SHSSSSWGMSRGSIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLADGRIK
PDQDDDTEIKISIKQENTDVNMIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRY
PSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPAN
EIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHL
VGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGR
LSYLAYWKSVILEYLCHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIR
REKMILDHMEKLKTCSRVNELDPECLRWTPILISNVAVSEEEREAEKEAERLMEQASCWE
KEEQEILSSRANSRQSPAKVQSKNKYLHSPESRPGAGERGQLMEMAKESSEEEEEEEDEE
EEDDEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINS
SVTTETISETTEVLNEPFDHSDEERPMPQLEPTCELELEVEEESRKPVLRRAYQHQPGKK
RQTELEEGKDNHCFKNAGPCRNNTDDDANNLKEGSKDNPEPLKCKQAWPKGTKRGVSKWR
QNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKEISEDRSSPALMEMEQEVRETTEAPLP
RDGNRREDSCVPGSPHKSPSEKPADLIKPEEEEEEEEEEEEGTVEKDPDDARSQEKEEPE
ISMSKEDHVHQDDHEEEEEEDEEPSHNEDHDADDEDDSHMESTGVEKEELPREAFKEVLE
NQEAFLDLSVQPSYSNPEVLMDCSVGTTASCHSEPKELSGDTETAPESDEEPPEEQAKKQ
DQKDSEEVESEFKEGNMATMEIDSETVQAVQSLTQENREQDDTFQDCAETQEACRSLQNY
THADQSPQIAATLDDCQQSDHSSPVSSVHSHPGQSVHSVNSPSVPTLENSYAQISPDQSA
ISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSIC
GNSSSQNSCSYSNLTSSNLTQSSCAVTQQMSNMSGSCSMLQQTTISSPPTCSVKSPQGCV
GERPPSSSQQLAQCSMAANFSPPMQLADIPETGNANIGLYERMGQSDFGAGHYPQPSATF
SLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQ
ATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHISMRTKSASLSPA
AATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGY
SMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHG
YMNTGMSKQSLNGSYMRR
NT seq 6177 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaatc
aaaaagcaaaagcaaaggccctctgaggagagaatctgccatgcggtcagcgcctcccat
gggttggataagaagactgtttctgaacagctggagctcagcgttcaggatggctccgtg
ctcagagtcaccaacaaaggcctcgcttcctacaaggacccagacaaccctgggcgcttc
tcggccgtcaaaccgggcacttttcctaagtcagccaaggggtcgagaggatcatgtaat
gatctccgcaatgtggattggaacaaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccttgaagaacatcgagaagtatctcagaagccagagtgatctcacg
agtaccaccaataacccagcctttcagcagcgcctgcgcctgggcgccaagcgcgctgtg
aacaacgggaggctgctgaaggacgggccacagtacagggtcaactacgggggcttagat
ggcaaggccaaagcggcaccccagtaccccagtgctttcccgtcctcgctcccgccggtc
agcctcctcccccacgagaaagaccagccccgtgctgatcccattccaatatgtagcttc
tgtttggggactaaagaatccaatcgtgaaaagaaaccagaagaacttctgtcctgtgca
gattgtggcagtagcgggcacccatcctgtttgaaattttgtcctgagttaacaacaaat
gtaaaggccttaaggtggcagtgcatcgaatgcaagacatgcagtgcatgtagaatccaa
ggcaaaaatgcagataatatgcttttttgtgactcctgtgatagaggattccatatggag
tgctgtgacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcaga
ccaaagaaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatat
gcaaaacccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagt
gatgaaggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagact
aaagtctgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcaga
ttggctgttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacc
tacatttctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggcctt
actaagttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttt
tcaaagcactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtg
ttggctacaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaaac
cccatctctggtcagagccccagttcacaaaagtccaacacttccacttcttctacctct
ccccagagttcttccagccagtccagtgtgccctcctttagcagtcttaccaataacagc
cagctgaaggcactctttgatggactttctcatatctataccactcagggacagtctcga
aaaaagggacacccaagttatgcaccacccaagcgtatgcgtcgtaaaactgacttatct
tccacggcaaaatctaaagcccatttctttggcaaaagagatattagaagtaggtttatt
tctcactcctcctctagctgggggatgtctagaggaagtatttttaaagcaattgctcac
ttcaagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtg
acccctcagatggggaccccctcaccagggaaggggagcttggcagacggaaggattaaa
cctgatcaggatgatgatacagaaataaaaataagcatcaaacaggaaaatacagatgta
aatatgattggaaacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcc
caggaactttcttgggagaaaatagagtgtgaaagtggggtggaagattgtggccggtac
ccttccgtaatagaatttggaaaatatgaaatccaaacctggtactcctcgccttaccca
caggaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaa
agtaaaaacattttgctaagacactcaaagaagtgtggatggtttcatcctccagcaaat
gaaatttaccgaaggaaagatctttcagtatttgaggttgatgggaatatgagcaaaatt
tattgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattat
gatgtcgagccattccttttttatgtccttacaaaaaatgatgaaaaaggctgtcatctg
gttggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatg
atcatgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttg
ctttctagaagagaaggccaagcagggtctcctgaaaagccactctctgatctgggccga
ctctcctacctggcctattggaagagtgtcatcttagaatacctctgccaccaccacgag
aggcacatcagcatcaaggcaattagcagagccacaggcatgtgcccccatgacatcgcc
accactctgcaacacctccacatgattgacaagagagatggcagatttgtcatcattaga
agggaaaagatgatattggaccacatggaaaagctgaaaacctgttcccgggtcaatgaa
cttgatccagagtgtctgaggtggacgccaattttaatttctaatgttgcggtttctgaa
gaagagcgggaagctgaaaaagaggctgagcggctgatggaacaagctagctgctgggaa
aaggaggagcaagaaatcctgtcatctagagcgaacagtaggcaatcacctgcaaaagta
caatcgaaaaataaatatttgcattccccggagagccggccaggagcaggggagcgaggg
cagctgatggaaatggccaaggagagcagtgaagaagaggaagaagaggaggacgaagag
gaggaggacgatgaggaggaggaagaggaggaggaggaagaggaggaagaggaggaggag
gaagaaaatatccaaagctctcctccacgattgactaaaccacagtccgttgccataaag
agaaagaggccttttgtactaaagaaaaaaaggggtcgtaaacgcaggaggatcaacagc
agtgtaacaactgagaccatttcggagacaactgaggtcctgaatgagccctttgaccac
tcagacgaggagaggccgatgccacagctggagcctacctgcgagctggagctggaggtg
gaggaggagagccggaagccggtcctgaggagagcataccaacaccagcccgggaagaag
aggcagacggagctggaggagggaaaagacaatcactgctttaagaatgctggcccctgc
agaaacaatacagatgacgatgcaaataacttgaaagaaggcagcaaagacaatcctgaa
cctctaaagtgcaagcaagcatggccaaaaggaacgaagcgaggtgtctctaaatggagg
caaaacaaagagcgaaagaccggatttaaactgaatttgtacaccccaccagaaacaccc
atggagccagatgagcaggtcacagtggaggagcagaaggagatttccgaagacagaagc
agccccgctctcatggagatggagcaggaggtgagggagaccacagaagccccattgcct
cgggatggaaacagaagggaagactcatgtgtgcctgggagtccacataaatcaccaagc
gagaagccagccgatctcatcaaacctgaggaagaggaggaggaagaggaggaggaggaa
gaaggaactgtagaaaaagacccagatgatgctagaagtcaggaaaaagaggaaccagaa
atttccatgtcaaaagaagaccatgtgcatcaggatgatcatgaagaggaagaggaagag
gacgaagagccatcacacaatgaggaccatgatgcagatgatgaagacgacagtcacatg
gagtccactggagtggagaaggaagaactcccaagagaagccttcaaagaagtgctggaa
aaccaggaggcttttttagaccttagtgttcagcccagttattcgaacccagaggtcctg
atggactgtagtgttggcaccacagcttcatgtcacagtgagcctaaggagctttctggg
gacactgaaactgcacctgagtctgatgaggagcccccagaagaacaggccaagaagcaa
gaccaaaaggacagcgaggaagtagagtctgagttcaaagagggaaacatggcaaccatg
gagatcgactcagagactgtccaggcggttcagtctttgacacaggagaacagagaacag
gacgacacctttcaggactgtgccgagacacaagaagcctgtagaagcctacagaactac
acacatgcagaccaaagtccacagatcgccgcaacgctggacgattgccaacagtcagac
cacagtagcccagtttcatctgtccattcccatcctggccagtcagtccattctgtcaac
agcccgagtgtccccaccctggagaacagctatgcccaaatcagccctgatcagagcgcc
atctcagtgccatctttacagaacatggaaaccagtccaatgatggatgtcccatccgtt
tccgatcactcacagcaagtcgtggacagcggatttagtgacctgggtagcatcgagagc
acaacagagaactatgaaaacccaagcagttatgattcaactatgggtggcagcatttgt
ggaaacagctcttcccagaacagctgctcctacagcaacctcacctccagcaacctgaca
cagagcagctgcgccgtcacgcagcagatgtccaacatgagtgggagctgcagcatgctg
cagcagaccaccatcagctctcccccaacctgcagcgtcaagtctccccagggctgtgtg
ggggagaggcccccgagcagcagccagcagctggcacagtgcagcatggcagccaacttc
tccccaccaatgcagctagccgacatccccgagacgggcaacgccaacattggcttatat
gagcgaatggggcaaagtgattttggggctgggcactacccacagccatccgcaaccttc
agccttgccaaactgcagcagttaactaatacacttattgatcattcattgccttacagc
cattccgctgctgtgacttcctatgcaaacagtgcctctttgtctacaccgttaagtaac
acagggcttgttcagctttctcagtctccacactctgtccctgggggaccccaagcacaa
gctaccatgaccccaccccccaacctgactcctcctccaatgaatctgccaccgcctctt
ttgcagcggaacatggccgcatccaacattggcatctcccacagccaaagactgcaaacc
cagattgccagcaagggccacatctccatgagaaccaagtcggcgtctctgtcaccagct
gctgccacccatcagtcacagatctatgggcgctcccagactgtagccatgcagggtcct
gcacggactttaacaatgcaaagaggcatgaacatgagtgtgaacctgatgccagcccca
gcctacaacgtcaactccgtgaacatgaacatgaacactctgaatgccatgaatgggtac
agcatgtcccagccaatgatgaacagtggctaccacagcaatcatggctacatgaatcag
acgccccagtaccctatgcagatgcagatgggcatgatgggcacccagccatatgcccag
cagccaatgcagaccccgccccacagtaacatgatgtacacagccccaggacatcacggc
tacatgaacacgggcatgtccaagcagtctctcaatgggtcctacatgaggaggtag

DBGET integrated database retrieval system