KEGG   Heterocephalus glaber (naked mole rat): 101720934Help
Entry
101720934         CDS       T02812                                 

Definition
acyl-CoA desaturase 1-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101720934
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101720934
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101720934
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101720934
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101720934
Lipid biosynthesis proteins [BR:hgl01004]
 Desaturase
  First
   101720934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 357 aa AA seqDB search
MPAHMLQEISSSYTTTTTITAPPSDDLQNGGEKVDKTSLYSEDIRPEMKDDIRDPNYEDE
EGPVPKLEYVWRNIILMALLHVGALYGITLVPTCKFYTWLWACMYYVVSGLGITAGAHRL
WSHRTYKARLPLKIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHV
GWLLVRKHPAVKEKGKLLDMSDLKAEKLVMFQRRYYIPGLLLLCFILPTLVPWYFWGETF
QHSLYVATFLRYSLVLNATWLVNSAAHLYGYRPYDKNINSRENILVSLGAVGEGFHNYHH
SFPYDYSASEYRWHINLTTFFIDCMAALGLAYDRKRVSKAAVLAKIKRTGDGSYKSG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcacatgctgcaggagatctccagctcctacacgaccaccaccaccatcaca
gcgcctccctctgacgacctgcagaatggaggcgagaaggtggacaaaacgtctctctac
tcagaagacattcgtcctgaaatgaaagatgacattcgcgaccccaactatgaggatgag
gagggtcctgtgcccaagctggagtatgtctggagaaacatcattctgatggctctgctg
cacgtgggagccctgtatgggataacactagttcccacctgcaagttctatacctggctg
tgggcatgcatgtactatgtagtgagtggactgggcatcacagcaggagctcatcgcctg
tggagccaccgaacttataaagcacggctgcccttgaagatcttcctgatcattgccaac
acgatggcgttccagaatgatgtgtatgaatgggcccgagaccatcgtgcccaccacaag
ttctcagagacacatgctgaccctcacaattcccgacgcggctttttcttctctcacgtg
ggttggctgcttgtgcgaaaacacccagcagtcaaagagaagggcaagttgcttgacatg
tctgatctaaaagctgagaaactggtgatgttccagaggaggtattatatacccggtctt
ctgttgctgtgcttcatcctgcccacactggtcccctggtatttttggggtgaaactttt
caacacagcttgtatgttgccaccttcctgagatactccctagtgctcaatgccacctgg
ctggtgaacagtgctgcccacctctatggatatcgcccatatgacaagaacattaactct
cgggagaacattctggtttcactaggagctgtgggtgagggcttccacaactaccaccac
tccttcccctatgactactctgccagtgagtaccgctggcacatcaatttaaccacattc
ttcattgattgcatggctgcccttggtctggcttatgatcggaagagagtatccaaggct
gctgtcttggccaagattaaaagaactggagatggaagctacaagagtggttga

DBGET integrated database retrieval system