KEGG   Heterocephalus glaber (naked mole rat): 101722310Help
Entry
101722310         CDS       T02812                                 

Gene name
Elp3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101722310 (Elp3)
Transfer RNA biogenesis [BR:hgl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101722310 (Elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCVGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIALEEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccccgctgagctaatgatgctgactatagga
gatgttattaaacaactgatcgaagcccatgaacaagggaaagacatcgatctcaataag
gtgaaaaccaagacagctgccaaatatggcctttcagcacagccccgcctggtggatatc
attgccgcagtccctcctcagtatcggaaagtcttagtccccaagttaaaggcaaaaccc
atcagaactgccagcgggattgctgttgttgctgtgatgtgtaaaccccacagatgccca
cacataagttttacgggaaacatatgtgtatactgccccggtggacctgattcagatttt
gaatattcaacccagtcctacactggatatgagccaacctccatgcgagctattcgggct
agatacgacccttacctgcagacaagacaccggatagaacagttaaaacagcttggtcac
agtgtggataaagtggagtttatcgtgatgggtggaactttcatggcccttccggaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacatccaacaat
atttatgaggcagtcaagtattctgagagaagcctcacaaagtgtgttggaattaccatc
gagaccaggccagattattgcatgaagcgacacttaagtgacatgttgacctatggctgc
acgaggctggagatcggagtgcagagtgtgtacgaagatgtggccagagacaccaacagg
ggccacactgtcaaggcagtatgtgagtcattccacctggccaaagattctggtttcaaa
gttgtggcccatatgatgcctgatctgccaaacgtgggactagaacgagacattgagcag
tttatagagttttttgagaaccctgcttttcgtcctgatggtatgaaactctaccctacc
ctggtgattcgtggcacagggctgtatgagctttggaaatcaggacgatataagagttat
tctcctagtgatctgatcgaactggtggctcggattctagcccttgttcctccatggact
cgagtgtaccgagtgcagagagacattcctatgcccttagtcagctcgggagtggagcat
ggcaacctgagagagctggcatttgcaagaatgaaagaccttggaatacagtgtcgggat
gtaagaaccagagaggttggaatccaagaaattcatcacaaagtacggccataccaggtt
gagttggtgaggagagattatgttgcaaatggtggctgggagacattcctgtcatatgaa
gaccctgaacaagacatactgatcggcctcctgcggttgcggaagtgttcagaggaaacc
ttccgcttcgagctgggtggaggtgtttccatcgtgcgggagctgcatgtgtatggaagt
gtggtccccgtgagcagccgggatcctactaagtttcagcatcaggggtttggcatgctg
ctgatggaggaagcagaaagaatagctctagaagaacacggatctgggaaaatagctgtt
atatcaggagttggcaccaggaattattataggaagattggctacagattacaaggcccg
tacatggtgaagatgctaaaataa

DBGET integrated database retrieval system