KEGG   Heterocephalus glaber (naked mole rat): 101722435Help
Entry
101722435         CDS       T02812                                 

Gene name
Padi3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 665 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETVVDIYGSVPEGTDMFEVYGTPGVDIYISPGTERSR
DQRADTRRWDFDEGLEIIVVMNSPSNDLNDSHVQISYHSSRESLPLAYAVLYLTCVDIAL
DCDLNYEGREDRNSVDKKQWVWGPGGYGAILLVNCDRDDLDCDVPDNRDQHVRCLQDLED
MSVMVLQTQGPAALFDDHKLVLHTSSFDAQRARVFHMCGPKDSWKAYKCVLGQDKVSYEV
PRLHGNEEHFFIEGLSFPDAGFQGLVSFHVTLLDDSNEDFSETPIFTDTVVFRVAPWIMT
PSTLPPLEVYVCRVRNNTRFVEAVEELASRAGCKLTICPQTENRNDRWIQDEMELGYVEA
PHKTFPVVFDSPRNGELQEFPYKRILGVDFGYVTREPRDKSVSGLDSFGNLEVSPPVVAN
GKEYPLGRILIGGNLPGSKGRRVTQVVRKFLHAQKVQPPVELFVDWLAVGHVDEFLSFVP
APDGKGFRMLLASPSDCFRLFQEKQKWGHGRALLFQGVISDRRVRTISIDQVLSNGNLIS
FNKFVQSCIDWNREVLKRELGLADRDIIDIPQLFKSEQRKAMAFFPDLVNMLVLGKYLGI
PKPFGPVINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHLLHGEVHCGTNVRRKPFDFKW
WNMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcagaggattgtacgtgtgtccctggagcatcccaccagtgctgtgtgcgtg
gctggcgtggagactgtcgtggacatatatggatcggttcccgagggcacagacatgttc
gaggtctacgggacccctggggtggacatctacatctcccccggcacggagaggagccgg
gaccagcgtgcagacaccaggcggtgggactttgatgagggcttggagatcatcgtggtc
atgaactcccccagcaacgacctcaatgacagtcatgtgcagatttcctaccactccagc
cgagagtctctgcccctggcctacgccgtgctctacctaacctgtgtggacattgccctg
gattgcgacctgaactatgagggcagggaggacaggaactctgtggacaagaagcagtgg
gtctgggggcctggtgggtatggagccatcttgctggtgaattgtgacagggacgatctg
gactgtgatgtcccggacaaccgtgaccagcatgtgcgatgcctgcaagatctggaagac
atgtccgtcatggtcctgcagacccagggtccagcagccctctttgatgaccacaaactc
gtgctccacacctccagttttgatgcccagcgggcacgggttttccacatgtgtggcccc
aaggactcctggaaggcctacaagtgcgtgctgggccaggacaaggtgtcgtatgaggtg
ccccgtctccacgggaatgaggagcacttcttcatagagggcctctccttccctgatgct
ggcttccaagggcttgtctccttccatgtcaccctgctggatgactccaacgaggacttc
tctgagaccccgatcttcaccgacactgtggtgttccgggtggcaccctggatcatgaca
cccagcaccctgccgcccctggaggtatatgtgtgccgtgtgaggaacaacacgcgtttc
gtggaagctgtggaggagctggcgagtcgggcaggctgcaaactgaccatctgcccacag
accgagaaccgcaatgaccgctggatccaggatgagatggagctgggctacgttgaggca
ccgcacaaaaccttcccagttgtcttcgactccccaaggaacggggagctgcaggagttc
ccttacaaaaggatcctgggtgtagattttggctacgtgactcgggaaccacgggacaag
tccgtgagcggcctggactcctttgggaacctggaggtcagccccccagttgtggccaac
ggaaaagagtaccctctggggcggatcctcatcgggggcaacctgcctgggtcgaagggc
cgcagggtaacccaggtggttcggaagttcctccatgcccagaaggtgcagccacccgtg
gagctcttcgtggactggctggccgtggggcatgtggatgagttcctgagctttgtccct
gccccagatggaaagggcttccggatgctcctggccagtccctccgactgcttccggctc
ttccaggagaagcagaaatggggtcatggcagggccctcctcttccagggagttatcagt
gacaggcgggtcaggaccatctccattgaccaggtcctttccaatggaaacctcatcagc
tttaataagtttgtgcagagctgcattgactggaatcgtgaggtgctgaagcgggagctg
ggcctggcggaccgtgacatcatcgacatcccgcagctcttcaagtccgagcagagaaag
gcaatggccttcttccctgacttggtgaacatgctggtgctgggcaagtacctgggcatc
cccaagccctttgggccggtcatcaacggccgctgctgcctagaggagaaggtacgctca
ctgctggagccactaggccttcactgcaccttcattgatgacttcaccccataccacctg
ctgcacggggaggtgcactgtggcaccaatgtgcgccggaagccctttgacttcaagtgg
tggaacatggtgccctga

DBGET integrated database retrieval system