KEGG   Heterocephalus glaber (naked mole rat): 101722644Help
Entry
101722644         CDS       T02812                                 

Gene name
St6gal2
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101722644 (St6gal2)
   00514 Other types of O-glycan biosynthesis
    101722644 (St6gal2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     101722644 (St6gal2)
Glycosyltransferases [BR:hgl01003]
 Terminal extension
  Sialyltransferase
   101722644 (St6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 528 aa AA seqDB search
MKPHLKQWRQCMLFGIFAWGLLFLAIFIYFTDSNPAEPAPSSLSFLETRRLLPVQGKQRA
IMGAAHEPVPPRTALRGRLVGPVHVAPADWPEAVWTQDDTGNEDEFFSSQVGRRSQSAFY
SEDDDYFFLGGEPGWYSHALGVLGLPGLPSPGQPSRRGHSRSSGPVPSRRAQKRARQSAR
SRVSLSLRGLDEDRPSAPLPGALLRRLWTGEASARMLSPRLQKAMRDYVRANKHGVQFRG
RRALRRAPAELLCALRRARPRTLDGTEPPFAALGWRSLVPATALSQLHPRGLRSCAVVMS
AGAILNSSLGAEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILTNPSYHFIDSSL
YKDVILVAWDPAPYSSNLYLWYKKPDYNLFTPYIQHRQRNPAQAFYILHPKFIWQLWDII
QENTKEKIQPNPPSSGFIGIIIMMSMCDEVHVYEYIPSVRQTELCHYHELYYDAACTLGA
YHPLLFEKLLVQRLNTGSQADLHRKGKVVLPGFRTAQCPAPGPGDAYS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacatttgaagcaatggaggcagtgcatgctcttcggaatatttgcgtggggg
ctcctcttcttggccattttcatctatttcaccgacagcaatcccgctgagcctgcacct
agctccctgtccttcctagagacacggcggctcctgccggtgcagggcaagcagcgcgcc
atcatgggcgccgcacacgagcccgttccaccccggaccgcgctgcgtggacgcctagtc
ggcccggtccacgtagcgcccgcggactggccggaagcggtctggacccaggatgacact
ggaaatgaggacgaattcttctcctctcaggtcgggaggagatcccaaagcgctttctac
tcggaggacgacgactacttttttctaggcggcgagccagggtggtacagccacgcgctg
ggggtcctggggctcccggggctcccctcccccggccagccctcccggcggggacactct
cggtcctcggggccggtccccagccggcgcgctcagaagagggcccggcagtcggccagg
agccgcgtgtcgttgtcattaagaggcctggatgaggaccggccgtccgcgcccctgccc
ggcgcgctcctgcggcggctgtggacaggcgaggcgtctgcgcgcatgctgagcccgcgc
ctgcagaaggccatgcgcgactacgtgcgcgccaacaagcacggagtgcagttccgcggg
cggcgcgcgctgcgccgggccccggccgagctgctgtgcgcgctcaggcgcgcgcgccca
cgcaccctggacggcaccgagccgcccttcgccgcgctcgggtggcggagcctggtccca
gccaccgccctgagccagctgcacccgcgcggcctgcgcagctgcgccgtggtcatgtcg
gcaggcgccatcctcaactcgtcactgggtgcagagatagattctcacgatgcagtgttg
aggtttaactctgctcctacgcgtggttatgagaaggatgttggaaataaaaccactatt
cgcatcatcaactcccagattctgaccaaccccagctatcacttcattgacagttcttta
tataaagatgtcattttggtggcctgggacccagctccttattcctccaatctctacctg
tggtataagaagccagattacaacctcttcactccatatattcagcaccgtcagagaaac
ccagctcaagcattttacattctgcatcctaaatttatatggcagctctgggacattatc
caagagaacacaaaggagaagatccagcccaacccaccatcctcagggttcatcggtatc
atcatcatgatgtccatgtgcgacgaggtacacgtgtacgaatacattccctccgtgcgg
cagacggagctctgccactaccatgagctgtactacgacgcagcctgcacgctgggcgcc
taccatccgctgctcttcgagaagctcctggtgcaacgcctcaacacgggctcgcaggcc
gacctgcaccgcaagggcaaggtggtgctgccgggcttccgcacggcacagtgccctgcg
cctggcccaggggatgcatactcttag

DBGET integrated database retrieval system