KEGG   Heterocephalus glaber (naked mole rat): 101723122Help
Entry
101723122         CDS       T02812                                 

Gene name
Padi6
Definition
peptidyl arginine deiminase, type VI
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101723122 (Padi6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 680 aa AA seqDB search
MSLQSVVQLSLDSPVHAVCVLGSCLVVDISGCAPKKCDSFMLTCSPKVLVVLKSQVTSGR
DKTSIWHPLSEPMSALVMMVLPSSVVDEDKVLVSYYCPYEEAPLATAVLYLTGIEVSLKT
DIYRDGQQEMPLNKQMKEKWLWGPTGWGAILLVNCSPAEVNQDTKTVLSEDIKDLSQMTL
TVQGPTSALKNYQLVLHTSEEEAEKARVYLPHGDTSGAFQIVLGPGCNSHTFNPLVNLGK
ETLYVEAIEFPSANFTGLISFSVSLIEDSPVPSIPETPVYKDTVVFRVAPCIFTPSTQMP
LEVYLYRDVKIQGFVDMVAALSEKTDSQVVSVYEDPNRLGRWLQDEMAFCYTEAPQKMTS
FVLDTPRATKLDEFPMKYALSPGVGYVIQHTKDHTVASLDTIGNLMVSPPVRAQGKEYPL
GRVLFGGSFYPSAESRMMSKSLCDFLHAQQVQAPVELFSDWLMTGHLDEFMCFIPVEEKK
ESSKGFRLLLASPRACYKLLQEKQEEGYGNATLFEGVSPSLLRSNGREAKTINQFLADKS
LRNQNDYVERCIRLNRAILREKLGLLEDDIIDIPQLFCLEQLTNVPSDQQPCRFFARPYF
PDVLRMIVMGKDLGIPKPFGPQIKGTCCLEEKICQLLEPLGLKCTFIDDFDCYLTDVGDF
CACTNIRRVPFAFKWWKMVP
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcagagtgtggtccagctctccctggacagccccgtccatgctgtgtgtgtg
ctaggctcctgccttgtcgtggacatcagcgggtgtgcccccaagaagtgtgactccttc
atgctcacctgctccccgaaggtgctggttgtcctgaagagccaggtgaccagcgggagg
gacaaaacttccatctggcacccgctgtccgagcccatgagcgcactggtgatgatggtg
cttcccagctctgtcgtggacgaggacaaggtgctggtctcatactactgcccctacgag
gaggcccccttggccacagcagtgctgtacctcacaggcatcgaggtctccctgaagacg
gatatctaccgtgatgggcaacaggagatgccactcaacaagcagatgaaggaaaagtgg
ctctggggcccaactggatggggggccatcctgcttgtgaactgcagccctgctgaagtg
aaccaggacacaaagactgtgttgtcagaagatataaaggacctgtcccagatgacgctg
actgtccaaggccccacctctgctttaaagaactatcagctggtccttcatacctctgag
gaagaggccgagaaggccagagtctacttgccgcatggagacacctctggcgcctttcag
attgtgctgggacccggctgtaactcccatacctttaacccactggtgaaccttgggaag
gagaccctctacgtggaagcgatagagttcccatctgccaacttcacaggcctgatctcc
ttctcggtctccctgattgaagattctccagtcccctcaattccagagaccccggtctac
aaggacacagtagtgttccgggtagctccctgcatcttcacccccagcactcagatgccg
ctagaggtgtacctgtacagagatgtgaagatccagggctttgtggacatggtggcggcg
ctgagtgagaagactgacagccaggtggtgtctgtctatgaggaccccaaccgcctgggc
aggtggctgcaggacgagatggccttctgctacactgaggccccccagaagatgacatct
tttgtcctggacacccctcgggccaccaagcttgatgagttccccatgaaatatgcactg
agccctggtgtgggctacgtgatccaacacaccaaggaccacacggtggccagcctggat
accattgggaacctgatggtgtccccacccgtcagggcccaggggaaagagtacccgttg
ggcagagtcctctttggtggcagcttctaccccagtgccgagagccggatgatgagcaag
agcctttgcgacttcctccacgcacagcaggtccaagcgcctgtggagctcttctcagac
tggctgatgaccggccacctggatgagttcatgtgcttcatcccagtggaagaaaagaaa
gagagctcaaagggcttccggttgctcctagccagccccagagcctgctacaagctgctc
caagagaagcaggaggaaggctatgggaacgcgactctgtttgagggtgtcagccctagc
ctgctgcgctctaacggaagggaggccaaaaccatcaaccagtttcttgctgacaaaagt
ttgagaaatcagaacgactatgtagagaggtgcattcgcctgaaccgcgccatcctgagg
gagaagctgggcctgctggaggatgacatcatcgacatcccccagctcttctgcctggag
cagctgaccaacgtcccctcggaccagcagccctgtagattctttgcgaggccctacttc
cctgacgtgcttcgaatgattgtgatgggcaaggatctggggatccccaagccctttggg
ccacaaatcaagggcacctgttgcctagaagaaaagatctgccagttactggagcccctg
ggcctcaagtgcaccttcattgatgactttgactgctacctgaccgatgtcggagacttc
tgtgcctgtaccaacatccgccgggtgccctttgccttcaagtggtggaagatggtgcct
tag

DBGET integrated database retrieval system