KEGG   Heterocephalus glaber (naked mole rat): 101723154Help
Entry
101723154         CDS       T02812                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    101723154
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     101723154
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101723154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKALLILGLLLLSVTIHGKIFERCELARTLKRFGLDGYRGISLPNWVCLARWESSYNTKA
TNYNPGDRSTDYGIFQINSHYWCNDGKTPGAVNACGISCNALLQDDITEAVACAKRVVRD
PQGIRAWVAWRHRCQNQDLTQYVRGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctccttattctggggcttctcctcctttctgtcaccatccatgggaagatc
tttgaaaggtgtgagttggccagaactctgaagagatttggactggatggctaccgggga
atcagcctgccaaactgggtgtgtttggccagatgggagagtagttataacacaaaagct
acaaactacaatcctggagacagaagcactgattatgggatatttcagatcaatagccac
tactggtgcaatgatggcaaaaccccaggagctgttaatgcctgcggtatatcctgcaat
gccttgttgcaagatgacatcactgaagcagtggcttgtgcaaagagggttgtgagggac
ccacaaggcattagagcatgggtggcatggagacatcggtgtcaaaaccaagatctcact
cagtatgtgcgtggctgtggagtgtaa

DBGET integrated database retrieval system